KEGG   Thermus thermophilus HB8: TTHA1671
Entry
TTHA1671          CDS       T00220                                 
Symbol
TTHA1671
Name
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00230  Purine metabolism
ttj00730  Thiamine metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01232  Nucleotide metabolism
ttj01240  Biosynthesis of cofactors
Module
ttj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TTHA1671 (TTHA1671)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    TTHA1671 (TTHA1671)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ttj04147]
    TTHA1671 (TTHA1671)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     TTHA1671 (TTHA1671)
Exosome [BR:ttj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTHA1671 (TTHA1671)
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Cytidylate_kin Thymidylate_kin AAA AAA_28 PAS_7 RuvB_N TIP49 Mg_chelatase
Other DBs
NCBI-ProteinID: BAD71494
UniProt: Q5SHQ9
Structure
Position
1:complement(1580253..1580813)
AA seq 186 aa
MDVGQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPLGERVRPIMERG
DLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVLVEVPEEELV
RRILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARI
RAALGI
NT seq 561 nt   +upstreamnt  +downstreamnt
gtggacgtgggacaggcggtgatcttcctgggacctccgggggcgggcaagggcacccag
gcctcgaggctcgcccaggagctcggcttcaagaagctctccacgggggacatcctccgg
gaccacgtggcccgggggacccctttgggcgagcgggtgaggcccatcatggagcggggg
gacctggtccccgacgacctcatcctggagcttatccgggaggagctggccgagcgggtg
atctttgacggcttcccccgcaccctggcccaggccgaggccttggaccgcctcctttcg
gagaccggcacccggctcctcggggtggtgctggtggaggtccccgaggaggagctcgtc
cggcgcatcctcaggcgggccgagctcgagggccgctccgacgacaacgaggagaccgtg
aggcgccgcctcgaggtctaccgggagaaaaccgagcccctggtgggctactatgaggcc
aggggggtgctgaagcgggtggacgggctcggcaccccggacgaggtctacgcccggatc
cgggcggcgttagggatctga

DBGET integrated database retrieval system