KEGG   Thermus thermophilus HB8: TTHA1706Help
Entry
TTHA1706          CDS       T00220                                 

Definition
(RefSeq) divalent heavy-metal cation transporter
Organism
ttj  Thermus thermophilus HB8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zip Flavi_NS4A
Motif
Other DBs
NCBI-GeneID: 3168488
NCBI-ProteinID: YP_144972
UniProt: Q5SHM4
Position
1601003..1601749
Genome map
AA seq 248 aa AA seqDB search
MEGLPITPWTVFLYAFLTAVATGLGALPFLFTRGITRRHLGLANAAAAGLMVAASFGLIY
EGVNYSLGRTLVGVGLGLLFILLAHRYLEGREVNLGDLKGLDARKALMMVGIMTLHSFAE
GVGVGVAFGGGEALGVFISLAIAVHNIPEGLAISLVLVPRGVSVLGAAFWSVFSSLPQPL
MAVPAYLFVETFQPFLPVGLGLAAGAMIWMAAAELLPDALKEAEAEGVATVLTLSVALMV
AFQILIGG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcctgcccatcactccctggacggtgttcctctacgccttcctcaccgccgtc
gccacaggcctcggcgccctccccttcctcttcacccgcgggatcacgcggcggcacctc
ggcctcgccaacgccgccgccgccgggctcatggtggcggcgagcttcggcctgatctac
gagggggtgaactacagcctggggcggaccctggtgggcgtgggcctcggcctcctcttc
atcctcctcgcccaccgctacctcgagggccgggaggtgaacctcggcgacctcaagggc
ctggacgcccgcaaggccctgatgatggtgggcatcatgacccttcactccttcgccgaa
ggggtgggggtgggggtggccttcgggggcggggaggccctcggggtcttcatctccttg
gccatcgccgtgcacaacatccccgagggactcgccatcagcctcgtcctcgttccccgg
ggggtgagcgtgctcggggccgccttttggagcgtcttctccagcctgccccagcccctc
atggccgtgcccgcctacctcttcgtggaaaccttccaacccttcctgccggtggggctt
ggcctcgccgccggggccatgatctggatggccgcggccgagctcctccccgacgccctg
aaggaggccgaggccgagggggtggccacggtcctcaccctctccgtggccctgatggtg
gccttccagatcctgatcgggggctaa

DBGET integrated database retrieval system