KEGG   Thermus thermophilus HB8: TTHA1710
Entry
TTHA1710          CDS       T00220                                 
Symbol
TTHA1710
Name
(GenBank) radical SAM domain protein
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TTHA1710 (TTHA1710)
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     TTHA1710 (TTHA1710)
SSDB
Motif
Pfam: Radical_SAM TF_Zn_Ribbon DZR HVO_2753_ZBP zf-RING_7 PknG_rubred zf-C4_Topoisom zinc_ribbon_2
Other DBs
NCBI-ProteinID: BAD71533
UniProt: Q5SHM0
Position
1:1604610..1605662
AA seq 350 aa
MTLAATLREADLFRSLPKGFVQCRACAHYCALPEGGAGKCGVRRNLGGRLYLVTYGKAAA
LHLDPVEKKPLYHFHPGEGILSVGTVGCNLFCAFCQNWQISQFREFRVSPEGRLDRPIGE
DWPPKRLVAEAEALGVRLLAYTYNEPAVWIEYAHDTARLAKARGMKNVFVTSGFETKEAW
DYIRPHLDAANVDLKGFTEKFYREVCGARLKPVLESLGHLVASGVWVEVTTLLLEGYNDS
DEEVRAMARFLKGLSPDIPWHLTAAHPDYRMLDLRSTRHATLVRAHAIAKEEGLRFVYVG
NVLDEERNSTYCPNCGRLLVRRRGYRVEALWEAPGVCPGCGQRIPGVWTW
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaccctggccgccaccctaagggaagcagacctcttccgctcccttcccaaaggcttt
gtccagtgccgggcctgcgcccactactgcgccctccccgagggcggggcggggaagtgc
ggggtgcggcgcaacctcgggggtaggctctacctggtcacctacggcaaggcggccgcc
cttcacctggacccggtggagaagaagcccctctaccacttccaccccggggaaggcatc
ctctccgtgggcaccgtggggtgcaaccttttctgcgccttctgccagaactggcagatc
tcccagttccgggagtttcgggtctccccggaagggcgcctggaccgccccatcggcgag
gactggcccccgaagcgcctcgtggcggaggcagaggccctgggcgtgaggcttctcgcc
tacacctacaacgagcccgccgtctggatagagtacgcccacgacaccgcccgcctggcc
aaggcccgggggatgaagaacgtcttcgtgacgagcgggtttgagaccaaagaggcctgg
gactacatcaggccccacctggacgcggccaacgtggacctgaagggcttcacggagaag
ttctaccgggaggtctgtggggcccggctcaagcccgtgctggaaagcctgggacacctg
gtggcgagcggggtgtgggtggaggtcaccacgcttctcctggagggctataacgactcg
gacgaggaggtccgggccatggcccgcttcctcaaggggctctcccccgacatcccctgg
cacctcaccgccgcccatcccgactaccgcatgctggacctgaggtccacccggcacgcc
accctggtccgggcccacgccatcgccaaggaggagggcctgaggttcgtgtacgtgggc
aacgtcctggacgaggaaaggaactccacttattgccccaactgcggcaggctcctggtg
cgccggcggggctaccgggtggaggccctgtgggaggccccgggggtctgccccgggtgc
ggccagcgcatccccggcgtatggacctggtga

DBGET integrated database retrieval system