KEGG   Thermus thermophilus HB8: TTHA1713
Entry
TTHA1713          CDS       T00220                                 
Symbol
TTHA1713
Name
(GenBank) conserved hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: UPF0047
Other DBs
NCBI-ProteinID: BAD71536
UniProt: Q5SHL7
Structure
Position
1:1607458..1607847
AA seq 129 aa
MEGVVRLEVPTPEEGFVNITRKVEAALSGHTGLVYLFVPHTTCGLTVQEGADPTVAQDLL
GRLAELAPRHRPQDRHLEGNSHAHLKSLLTGVHLLLLAEKGRLRLGRWQQVFLAEFDGPR
VREVWVRLL
NT seq 390 nt   +upstreamnt  +downstreamnt
atggaaggcgtggtgcgcctcgaggtccccacccccgaggaggggttcgtgaacatcacc
cgcaaggtggaggcggccctctcgggccatacgggcttggtctacctcttcgtcccccac
accacctgcggccttacggtccaggaaggggccgaccccacggtggcccaggacctctta
ggccggctcgccgagctcgccccccggcaccgcccccaggaccggcacctagaggggaac
tcccacgcccacctcaagagcctcctcaccggggtccacctcctcctcctggcggagaag
gggcggctgaggcttgggcgctggcagcaggtcttcctggcggagtttgacggcccccgg
gtgcgggaggtctgggtgcgcctcctctaa

DBGET integrated database retrieval system