KEGG   Thermus thermophilus HB8: TTHA1765Help
Entry
TTHA1765          CDS       T00220                                 

Definition
(RefSeq) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_CIII Cytochrom_c3_2 Cytochrome_C7 Paired_CXXCH_1 Haem_bd
Motif
Other DBs
NCBI-GeneID: 3169437
NCBI-ProteinID: YP_145031
UniProt: Q5SHG5
Position
complement(1653647..1654285)
Genome map
AA seq 212 aa AA seqDB search
MRRRNRWLKTLFWGSVLGVFLALVLVFSGVAVGALEQREGRPVPQPVPFSHAFHAGGLGL
SCRYCHSAVEYAPYAGLPPTETCMTCHLYVKPDSPNLALVRESWEKGEPLRWNRVVNLPD
FVYFHHAPHVAKGVGCAECHGRVDQMPVVYQPKAFTMKFCLDCHRNPAPRLRPREQVFNM
AYVPDPELGRELLKLYHVRPPEELTSCNICHR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagacggagaaaccgttggctcaagaccctcttctgggggtcggtgttgggggtcttc
ctcgccttggtcctggtcttctccggggtggcggtgggggctttggagcagcgggagggg
cggcccgtgccccagcccgtccccttcagccacgccttccacgccgggggtctcggcctt
tcctgccgctactgtcattccgccgtggagtacgccccctacgccgggcttccccccacg
gagacctgcatgacctgccacctctacgtgaagccggatagccccaacctggccctcgtg
cgggagagctgggagaaaggggagcccctccgctggaaccgggtggtcaacctccccgac
ttcgtctacttccaccacgcccctcacgtggccaagggggtggggtgcgccgagtgccac
ggccgggtggaccagatgcccgtggtctaccagcccaaggccttcaccatgaagttctgc
ctggactgccaccggaaccccgcaccgcgcctgaggccccgggagcaggtcttcaacatg
gcctacgttccggaccccgagttgggacgggagctcctcaagctctaccacgtccggccc
cccgaggagctcacgagctgcaacatctgccaccgctag

DBGET integrated database retrieval system