KEGG   Thermus thermophilus HB8: TTHA1795
Entry
TTHA1795          CDS       T00220                                 
Symbol
TTHA1795
Name
(GenBank) MutT/nudix family protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: NUDIX NUDIX_4
Other DBs
NCBI-ProteinID: BAD71618
UniProt: Q5SHD5
Position
1:1676612..1677028
AA seq 138 aa
MPRKRSVALAAWGEEGLLLVLRPQDDPEFPGAWGLPAVSLQGEETLEEAALRVAREKLGA
EVAEAGPIAFGVEERPGYTLELWVYEGRLLGRPRLPEPKPGKTYYAAFRFGRPEELKAAA
RQGSLCSRLFLAVKGLCP
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcccaggaagcgctccgtggccctggccgcctggggcgaggaagggctcctcctcgtc
ctccgcccccaggacgaccccgagtttcccggggcctgggggcttcccgcggtgagcctc
cagggggaggagaccctggaggaggccgccttaagggtcgcccgggagaagctcggcgcg
gaggtggccgaggccgggcccatagccttcggcgtggaggagcggccggggtacaccctg
gagctttgggtctacgagggaaggcttctgggaaggccccgcctccctgagcccaagccg
ggcaagacctactacgcggccttccgcttcggccggcccgaggagctcaaggcggccgcg
aggcaaggctccctttgcagccggctcttcctcgcggtcaaggggctttgcccctag

DBGET integrated database retrieval system