KEGG   Thermus thermophilus HB8: TTHA1797
Entry
TTHA1797          CDS       T00220                                 
Symbol
TTHA1797
Name
(GenBank) probable amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00970  Aminoacyl-tRNA biosynthesis
ttj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TTHA1797 (TTHA1797)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ttj03029]
    TTHA1797 (TTHA1797)
Enzymes [BR:ttj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TTHA1797 (TTHA1797)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TTHA1797 (TTHA1797)
Mitochondrial biogenesis [BR:ttj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TTHA1797 (TTHA1797)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: BAD71620
UniProt: Q5SHD3
Structure
Position
1:1678246..1679550
AA seq 434 aa
MDLLEAKRLLETGRTTPLALLEEALERAKAFQDRNALAYLDEEAARKEALALTEELRRGQ
VRGPLHGLPLTVKDLFPVKGMPTRAGTKAPLPPLPEEARAVRRLREAGALLFAKTNMHEI
ALGITGENPWTGPVRNAVDPSRQAGGSSGGSAVAVALGIGLASLGTDTGGSIRIPAGFNG
VVGFKPSYGRVSLEGALPLSRSTDHAGPLTRSVRDAHFLTEILAGESIPLEGVQNPVFGV
PLDFLEGRLGVEVRKAFTRLLEDLPALRAEVREVSLPLEGVYEVYTRLVRYEAARIHEKA
LKEHPEGFSPQVREALLAGLALTEKDYRDAVAEREALRLELVKALRGVDALLLPVQPLPA
PPLGTEEVELESGRKGHREAFITLTLPFSLLGVPTLALPFAKVEGMPVGLQVVGAYGEDG
KVLALGGWLEARLG
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggacctgcttgaggcgaagcgccttctggaaacgggaaggaccacccctctagccctt
ttggaagaggccctggagcgggccaaggccttccaggaccggaacgccctcgcctacctg
gacgaggaggccgcccgcaaggaggccctggccctcacggaggagctcaggcggggccag
gtgcgggggcctctccacggccttcccctcaccgtaaaggacctcttccccgtgaagggg
atgcccacccgggcggggacgaaggcccccctccctccccttcccgaggaggcgagggcg
gtgcgccgcctgagggaggccggggccctcctcttcgccaagaccaacatgcacgagatc
gccctgggcatcaccggggagaacccctggacgggcccggtgcggaacgccgtggacccc
agccgccaggccggggggtctagcggcgggagcgccgtggccgtggccttagggatcggc
ctcgcctccctgggcacggacaccggggggtccatccgcatccccgcgggcttcaacggg
gtggtgggcttcaagccctcctacggccgggtgagcctggaaggggcccttcccctctcc
cgctccacggaccacgccgggcccctcacccggagtgtgcgggacgcccacttcctcacg
gagatcctggccggggagagcattcccttggagggcgtccagaaccccgtcttcggggtc
cccctggacttcctggaggggaggcttggggtggaggtgcggaaggccttcacccggctc
ttggaagatctccccgccctaagggccgaggtgagggaggtctcccttcccctggaaggc
gtctacgaggtctacacccgcctggtgcgctacgaggcggcccggatccacgagaaggcc
ctgaaggagcatcccgaaggcttctccccccaggtgcgggaagccctcctcgcgggcctc
gccctcacggagaaggactaccgggacgccgtggccgagcgggaggcgctcaggctggag
ctggtgaaggccctgaggggggtggacgccctcctcctccccgtccagcccctccccgcc
cctcccttgggcacggaggaggtggagctggagtccggcaggaagggccaccgcgaggcc
ttcatcaccctcaccctgcccttcagcctcctcggggtccccaccctcgccctccccttc
gccaaggtggaggggatgccggtggggctccaggtggtgggggcgtacggggaggacggg
aaggtcctggccctcgggggctggctcgaggcccggctaggctag

DBGET integrated database retrieval system