KEGG   Thermus thermophilus HB8: TTHA1806
Entry
TTHA1806          CDS       T00220                                 
Symbol
TTHA1806
Name
(GenBank) MutM protein (formamidopyrimidine-DNA glycosylase) (Fpg)
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    TTHA1806 (TTHA1806)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1806 (TTHA1806)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     TTHA1806 (TTHA1806)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     TTHA1806 (TTHA1806)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     TTHA1806 (TTHA1806)
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS NFACT_N Nudix_N_2 zinc-ribbons_6 TF_Zn_Ribbon
Other DBs
NCBI-ProteinID: BAD71629
UniProt: O50606
Structure
Position
1:1684475..1685278
AA seq 267 aa
MPELPEVETTRRRLRPLVLGQTLRQVVHRDPARYRNTALAEGRRILEVDRRGKFLLFALE
GGVELVAHLGMTGGFRLEPTPHTRAALVLEGRTLYFHDPRRFGRLFGVRRGDYREIPLLL
RLGPEPLSEAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPA
RSLTEEEARRLYRALREVLAEAVELGGSTLSDQSYRQPDGLPGGFQTRHAVYGREGLPCP
ACGRPVERRVVAGRGTHFCPTCQGEGP
NT seq 804 nt   +upstreamnt  +downstreamnt
gtgcccgagcttcccgaggtggagaccacccgtaggcggctgcgccccctggtcctgggc
cagacccttaggcaggtggtccaccgcgaccccgcccgctaccggaacacggccctggcg
gaggggaggcggatcctggaggtggaccgccgggggaagttcctcctcttcgccctcgag
ggcggggtggagctcgtggcccacctggggatgacgggggggttccggctggagccgacg
ccccacacccgggcggccctggtcctcgagggccggaccctctacttccacgacccccgg
cgcttcgggcgcctctttggggtgcggcgcggggactaccgggagatccccctcctcctc
cgcctcggccccgagcccctctcggaggccttcgcctttcccgggttcttccgagggctg
aaggagagcgcgaggccccttaaggccctcctcctggaccagcgcctcgccgccggggtg
ggcaacatctacgccgacgaggccctcttccgcgcccgcctaagccccttccgccccgcc
cgaagcctcaccgaggaggaggcgcggcgcctctaccgggccctgcgcgaggtgctggcg
gaggccgtggaactcgggggaagcaccctctcggaccaaagctaccgccagcccgacggc
ctccctgggggcttccagacgcgccacgccgtctacggccgggagggcctcccctgcccg
gcctgcgggcgcccggtggagcggcgggtggtggccgggcggggcacccacttctgcccc
acctgccagggggaaggcccctag

DBGET integrated database retrieval system