KEGG   Thermus thermophilus HB8: TTHA1813Help
Entry
TTHA1813          CDS       T00220                                 

Gene name
rpoB
Definition
(RefSeq) DNA-directed RNA polymerase subunit beta
  KO
K03043  DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    TTHA1813 (rpoB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ttj03021]
    TTHA1813 (rpoB)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1813 (rpoB)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     TTHA1813 (rpoB)
Transcription machinery [BR:ttj03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     TTHA1813 (rpoB)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      TTHA1813 (rpoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpb2_45 RNA_pol_Rpb2_2
Motif
Other DBs
NCBI-GeneID: 3169736
NCBI-ProteinID: YP_145079
UniProt: Q8RQE9
Structure
PDB: 

Position
complement(1694259..1697618)
Genome map
AA seq 1119 aa AA seqDB search
MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKG
KGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPL
MTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNG
VVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKD
EVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERML
MGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTR
ERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVF
SVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEED
GEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPA
SENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGE
KARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLA
NRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQR
YISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQP
LGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPS
VPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggagatcaagcggttcggtcgcatccgagaggttatcccccttccacccctcaccgag
atccaggtggagtcctaccgcagggccctgcaggccgacgtccccccggagaagcgggag
aacgtcggcatccaggcggccttccgggagaccttccccattgaggaggaggacaagggc
aagggcggtttggtgctggacttcctggagtaccgcctgggcgagccccccttcccccag
gacgagtgccgggagaaggacctcacctaccaggcccccctctacgcccggctccagctc
atccacaaggacacgggcctcatcaaggaggacgaggtcttcctggggcacatccccctg
atgaccgaggacggctccttcatcatcaacggggccgaccgggtcatcgtctcccagatc
caccgctcccccggggtctacttcacccccgaccccgcccggcccgggcgctacatcgcc
agcatcatccccctgcccaagcggggcccctggattgacctggaggtggagccgaacggc
gtcgtctccatgaaggtcaacaagcggaagttccccctggtcctcctccttcgggtcctg
gggtacgaccaggagaccctggcccgggagcttggggcctacggggagctggtccagggc
ctcatggacgagagcgtcttcgccatgcgccccgaggaggctctgatccgcctcttcacc
ctcctccgccccggggacccgcccaagcgggacaaggccgtggcctacgtctacggcctc
atcgccgaccccaggcggtacgacctgggcgaggccgggcggtacaaggcggaggagaag
ctggggatccgcctctcgggccgcaccctggcccgctttgaggacggggagttcaaggac
gaggtcttcctccccaccctccgctacctcttcgccctcaccgccggggtcccgggccac
gaggtggacgacattgaccacctgggcaaccgccgcatccgcaccgtgggggagctcatg
accgaccagttccgggtggggctcgcccgcctcgcccggggggtgcgggagcggatgctc
atgggctcggaggacagcctcaccccggccaagctggtgaacagccgccccttggaggcc
gccatccgggagttcttcagccgcagccagctttcccagttcaaggacgagaccaacccc
ctctcctccctgcgccacaagcggcggatctccgccctgggcccgggcggcctcacccgg
gagcgggcggggtttgacgtgcgcgacgtccaccgcacccactacgggcgcatctgcccc
gtggagacccccgagggcgccaacatcggcctcatcacctccttggcggcctacgcccgg
gtggacgagctgggcttcatccgcaccccctaccgccgggtggtgggcggggtggtcacc
gacgaggtggtctacatgacggccaccgaggaggaccgctacaccatcgcccaggccaac
acccccctggaggggaaccggatcgcggccgagcgggtggtggcccggaggaagggggag
cccgtgatcgtgagcccggaagaggtggagttcatggacgtctcccccaagcaggtcttc
tccgtgaacaccaacctcattcccttcctggagcacgacgacgccaaccgggccctcatg
ggctccaacatgcagacccaggccgtgcccctcatccgggcccaggcccccgtggtgatg
acgggcctcgaggagcgggtggtgcgggactccctggccgccctctacgccgaggaggac
ggggaggtggccaaggtggacggcaaccgcatcgtcgtgcgctacgaggacggccgcctg
gtggagtaccccttgcgccgcttctaccgctccaaccagggtacggccctggaccagcgc
ccccgggtggtggtggggcagcgggtgcgcaaaggggacctcctcgccgacggccccgcc
tccgagaacggcttcctggccctggggcagaacgtcctcgtggccatcatgccctttgac
gggtacaactttgaggacgccatcgtcatcagcgaggagctcctcaagcgggacttctac
acctccatccacattgagcgctacgagattgaggcccgggacaccaagcttggccccgag
cggatcacccgggacatcccccacctctccgaggccgccctaagggacctggacgaggag
ggcgtggtgcgcatcggcgccgaggtgaagcccggggacatcctcgtggggcggaccagc
ttcaagggcgagtccgagcccacccccgaggagaggctcctccgctccatcttcggcgag
aaggcccgggacgtgaaggacacctccctccgggtgccgcccggcgaaggggggatcgtg
gtccgcaccgtccggctgcggcggggcgaccccggggtggagctcaagcccggggtgcgg
gaggtggtccgggtctacgtggcccagaagcgcaagctccaggtgggggacaagctcgcc
aaccgccacgggaacaagggggtggtggccaagatcctccccgtggaggacatgccccac
ctgcccgacggcacccccgtggacgtgatcctgaaccccctgggcgtccccagccggatg
aacctggggcagatcctggagacccacctgggcctcgccgggtacttcctgggccagcgc
tacatctcccccatctttgacggggccaaggagcccgagatcaaggagctcctcgcccag
gcctttgaggtctacttcggcaagcgcaagggcgagggcttcggcgtggacaagcgggag
gtggaggtcctccgccgggcggagaagctcggcctcgtcaccccgggcaagaccccggag
gagcagcttaaggagctcttcctccagggcaaggtggtcctctacgacggccgcacgggc
gagcccattgagggccccatcgtggtgggacagatgttcatcatgaagctctaccacatg
gtggaggacaagatgcacgcccgctccacggggccctactccctcatcacccagcagccc
ctgggcgggaaggcccagttcggcggccagcgcttcggggagatggaggtctgggccctc
gaggcctatggggcggcccacaccctccaggagatgctcacccttaagtccgacgacatt
gagggcaggaacgccgcctacgaggccatcatcaagggggaggacgttcccgagcccagc
gtccccgagtccttccgcgtgctggtgaaggagctccaggccttggccttggacgtgcag
accctggacgagaaggacaaccccgtggacatctttgaggggttggcctccaagcggtga

DBGET integrated database retrieval system