KEGG   Thermus thermophilus HB8: TTHA1816
Entry
TTHA1816          CDS       T00220                                 
Symbol
TTHA1816
Name
(GenBank) rod shape-determining protein MreB
  KO
K03569  rod shape-determining protein MreB and related proteins
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ttj03036]
    TTHA1816 (TTHA1816)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ttj04812]
    TTHA1816 (TTHA1816)
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHA1816 (TTHA1816)
Chromosome and associated proteins [BR:ttj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    TTHA1816 (TTHA1816)
Cytoskeleton proteins [BR:ttj04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    TTHA1816 (TTHA1816)
Prokaryotic defense system [BR:ttj02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    TTHA1816 (TTHA1816)
SSDB
Motif
Pfam: MreB_Mbl FtsA HSP70 Actin PilM_2 DDR Ppx-GppA EutA FGGY_C
Other DBs
NCBI-ProteinID: BAD71639
UniProt: Q5SHB4
Position
1:complement(1698884..1699921)
AA seq 345 aa
MLKGEDIGIDLGTASVLIYVRGKGIVLKEPSVIAVVQGKREVKAVGAEAYRMLGRTPGNI
VAVRPLKDGVIADYALTEKMLLLFLQKVLSPMSRLFKGRVRIMVGVPSGVTDVERRAVVQ
AVSTLAHKVYLIEEPLAAAIGAGINVAEPTGSMVVDIGGGSTDIAVISLGGIVRSESLRI
AGNEMDQAIILHIRQKYNLLIGERTAEELKIRLGRAKLLPGEEKEVAEVRGRDLLTGLPR
TAEIPAEDIVEALQEPLSKIFQGVRNVLESTPPELASDIYERGILLTGGGALLRNLDVAL
QEATGVPVVVAENPIEAVALGTGKALEMLHVLEDTILSSDDVLRR
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgcttaaaggcgaagacatcggcattgacctggggacggccagcgtcctcatctacgtg
cgggggaaggggatcgtcctgaaggagccctccgtcatcgccgtggtccaggggaaacgg
gaggtgaaggccgtgggggcggaggcctaccggatgctcgggcgcacccccgggaacatc
gtggccgtgcgccccctcaaggacggggtcatcgccgactacgccctcacggagaagatg
ctcctcctcttcctgcagaaggtcctttcccccatgagccgcctcttcaaggggcgggtg
cggatcatggtgggggttccctccggggtgacggacgtggagcggcgggccgtggtccag
gccgtctccaccctggcccacaaggtctacctcattgaggaacccttggcggccgccatc
ggggcggggatcaacgtggccgagcccacggggagcatggtggtggacatcgggggcggc
tccacggacatcgccgtcatctccttgggcgggatcgtgcgctcggagagtctccgcatc
gccgggaacgagatggaccaggccatcatcctccacatccgccagaagtacaacctcctc
atcggggagcgcaccgccgaggagctcaagatccggctgggccgggccaagctcctcccc
ggggaggagaaggaggtggccgaggtccggggccgggacctcctcaccggccttccccgc
accgccgagatccccgccgaggacatcgtggaggccctccaggagcccttgagcaagatc
ttccagggggtgaggaacgtcctggagagcactcccccggagcttgcctcggacatctac
gagcggggcatcctcctcaccgggggcggggccctccttaggaacctggacgtggccctg
caggaggccaccggcgtccccgtggtggtggcggagaaccccattgaggccgtggccctg
ggcactgggaaggccctggagatgctccacgtcctcgaggacaccatcctctcctccgac
gacgtcctgaggaggtga

DBGET integrated database retrieval system