KEGG   Thermus thermophilus HB8: TTHA1892
Entry
TTHA1892          CDS       T00220                                 
Symbol
TTHA1892
Name
(GenBank) excinuclease ABC subunit B (UvrB)
  KO
K03702  excinuclease ABC subunit B
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    TTHA1892 (TTHA1892)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1892 (TTHA1892)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     TTHA1892 (TTHA1892)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      TTHA1892 (TTHA1892)
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR AAA_30 DEAD AAA_16 AAA_22 AAA_19 HerA_C AAA_7 AAA
Other DBs
NCBI-ProteinID: BAD71715
UniProt: Q56243
Structure
Position
1:complement(1775514..1777511)
AA seq 665 aa
MTFRYRGPSPKGDQPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVL
APNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLR
HSTTRSLLTRRDVIVVASVSAIYGLGDPREYRARNLVVERGKPYPREVLLERLLELGYQR
NDIDLSPGRFRAKGEVLEIFPAYETEPIRVELFGDEVERISQVHPVTGERLRELPGFVLF
PATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLYDLEMLRVMGTCPG
VENYARYFTGKAPGEPPYTLLDYFPEDFLVFLDESHVTVPQLQGMYRGDYARKKTLVDYG
FRLPSALDNRPLRFEEFLERVSQVVFVSATPGPFELAHSGRVVEQIIRPTGLLDPLVRVK
PTENQILDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFERQ
ALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNA
RGEVWLYADRVSEAMQRAIEETNRRRALQEAYNLEHGITPETVRKEVRAVIRPEGYEEAP
LEADLSGEDLRERIAELELAMWQAAEALDFERAARLRDEIRALEARLQGVRAPEPVPGGR
KRKRR
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgaccttccgctaccgggggccaagccccaagggggaccagcccaaggccatcgccggg
ctcgtggaggccttgagggacggggagcgcttcgtcaccctcctcggggccacgggcacg
gggaagacggtgaccatggccaaggtcattgaggccctgggaaggcccgctttggtcctc
gcccccaacaagatcctcgcggcccagcttgcggcggagtttagggagctcttcccggaa
aacgctgtagagtacttcatcagctactacgactactaccagcccgaggcctacgtcccg
gggaaggacctctacatagagaaggacgcctccatcaaccccgagattgagcgcttaagg
cactccaccacccgaagcctcctcacgcggcgggacgtgatcgtggtggcctcggtctcg
gccatctacggcctcggggacccgagggagtacagggccaggaacctggtggtggaaagg
ggcaagccctaccccagggaggtccttttggagcgcctcctggaactcggttaccagcgg
aacgacatagacctttccccggggcgcttccgggcgaagggggaggtgttggagatcttc
cccgcctacgagaccgagcccatccgggtggagctctttggcgacgaggtggagcgcatc
tcccaggtgcaccccgtcaccggggagcggcttcgggagcttcccgggtttgtcctcttt
cccgccacccactacctctccccggaaggccttgaggagatcctgaaggagattgagaag
gagctctgggagagggtccgctactttgaggaaagaggggaagttctctacgcccagcgc
ctcaaggagcgcaccctctacgacctggagatgctaagggtcatgggcacctgccccggg
gtggagaactacgcccgctacttcacggggaaggccccaggggaacctccttacaccctc
ctggactacttccccgaggacttcctggtcttcctggacgagtcccacgtgaccgtgccc
cagcttcaggggatgtaccggggggactacgcccgcaagaagaccctggtggactacggc
ttccgcctcccctcggcgttggacaaccgcccccttcgctttgaggagtttttggagagg
gtttcccaggtggtcttcgtctccgccaccccggggccctttgagctagcgcattcgggg
cgcgtggtggagcagatcatccggcccacggggctattggaccccctggtgcgggtcaag
cccacggagaaccagatcctggacctcatggaggggatccgggagagggcggcaaggggc
gagcgcaccctggtcacggtcctcacggtgcgcatggccgaggagctcacgagctttttg
gtggagcacgggataagggcgcgctacctccaccacgagctggacgcctttgagcgccag
gccctgatccgggacctgaggcttggccactacgactgcctcgtggggatcaacctcctc
cgggagggcctggacatccccgaggtctccctggtggccatcctggacgcggacaaggag
ggcttccttagaagcgagcggagcctcatccagaccatcggccgggcggcgaggaacgcc
aggggcgaggtctggctctacgccgaccgggtctccgaggccatgcagagggccatagag
gagacgaaccggagaagggccctccaggaggcctacaacctggagcacggcatcaccccg
gagacggtgcggaaggaggttagggccgtcatccgccccgagggctacgaggaggccccc
ctcgaggccgacctctccggggaggacctgagggagaggatcgccgagctggagcttgcc
atgtggcaggcggcggaggctttggactttgagcgggcggcgaggcttagggacgagatc
cgggccctcgaggcccgcctccagggcgtaagggcccctgagcccgtccccggggggcgg
aagcggaagcggaggtga

DBGET integrated database retrieval system