KEGG   Thermus thermophilus HB8: TTHA1898
Entry
TTHA1898          CDS       T00220                                 
Symbol
TTHA1898
Name
(GenBank) A/G-specific adenine glycosylase (MutY)
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    TTHA1898 (TTHA1898)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1898 (TTHA1898)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     TTHA1898 (TTHA1898)
DNA repair and recombination proteins [BR:ttj03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     TTHA1898 (TTHA1898)
 Prokaryotic type
     TTHA1898 (TTHA1898)
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH TPR_16 EndIII_4Fe-2S HHH_8 TPR_6 DUF6415
Other DBs
NCBI-ProteinID: BAD71721
UniProt: Q5SH32
Position
1:complement(1784531..1785508)
AA seq 325 aa
MEAWRKALLAWYRENARPLPWRGEKDPYRVLVSEVLLQQTRVEQALPYYRRFLERFPTLK
ALAAASLEEVLRVWQGAGYYRRAEHLHRLARSVEELPPSFAELRGLPGLGPYTAAAVASI
AFGERVAAVDGNVRRVLSRLFARESPKEKELFALAQGLLPEGVDPGVWNQALMELGATVC
LPKRPRCGACPLGAFCRGKEAPGRYPAPRKRRAKEERLVALVLLGRKGVHLERLEGRFQG
LYGVPLFPPEELPGREAAFGVRSRPLGEVRHALTHRRLRVEVRGALWEGEGEDPWKRPLP
KLMEKVLRKALPLLAHAGVVPLPDA
NT seq 978 nt   +upstreamnt  +downstreamnt
gtggaggcctggcggaaagccctcctcgcctggtaccgggaaaacgcccgccccctcccc
tggcggggggagaaggacccttaccgcgtcctggtctccgaggtccttctgcagcagacc
cgggtggagcaggccctcccctattaccgccgctttctggagcgctttcccaccctgaag
gccctggccgcggcttccctggaagaggtccttagggtctggcagggggcgggctactac
cggcgggcggaacacctccaccgcctggcccgaagcgtggaggagcttcccccgagcttc
gccgagcttcgggggcttcctggtctcgggccttacaccgcggcggcggtggcctccatc
gccttcggggagcgggtggcggcggtggacgggaacgtccggagggtcctctcccgcctc
ttcgcccgggaaagccccaaggagaaggagcttttcgccctcgcccagggcctcctcccc
gagggcgtggacccgggggtgtggaaccaggccctcatggagctcggggccacggtctgc
ctgccgaaacggccccgttgcggggcctgccccctaggggccttctgccgggggaaggag
gcccccgggcgctaccccgcgcccaggaagcgccgggcgaaggaggagcgcctcgtcgcc
ctcgtcctcctcgggcggaagggggtgcacctggaaaggcttgaggggcgcttccagggc
ctctacggcgtccccctctttccccctgaggagcttcccgggcgggaggcggccttcggg
gtgaggtctaggcccctaggcgaggtgcgccacgccctcacccaccggaggcttcgcgtg
gaggtgcggggggccctttgggaaggggagggggaggacccctggaagaggcccctaccc
aagctcatggagaaggtgctccgcaaggcgcttcccctcctcgctcatgcgggcgtagtc
cccctcccggacgcatag

DBGET integrated database retrieval system