KEGG   Thermus thermophilus HB8: TTHA1952
Entry
TTHA1952          CDS       T00220                                 
Symbol
TTHA1952
Name
(GenBank) DNA polymerase III holoenzyme tau subunit
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03030  DNA replication
ttj03430  Mismatch repair
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TTHA1952 (TTHA1952)
   03430 Mismatch repair
    TTHA1952 (TTHA1952)
   03440 Homologous recombination
    TTHA1952 (TTHA1952)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttj03032]
    TTHA1952 (TTHA1952)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1952 (TTHA1952)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TTHA1952 (TTHA1952)
DNA replication proteins [BR:ttj03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     TTHA1952 (TTHA1952)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     TTHA1952 (TTHA1952)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA AAA_22 DNA_pol3_gamma3 RuvB_N AAA_30 AAA_5 TIP49 DNA_pol3_delta ResIII AAA_16 AAA_14 T2SSE AAA_19 AAA_25 Rad17 AAA_28 AAA_18 TsaE DUF815 RNA_helicase
Other DBs
NCBI-ProteinID: BAD71775
UniProt: Q5SGX8
Position
1:1828653..1830242
AA seq 529 aa
MSALYRRFRPLTFQEVVGQEHVKEPLLKAIREGRLAQAYLFSGPRGVGKTTTARLLAMAV
GCQGEDPPCGVCPHCQAVQRGAHPDVVEIDAASNNSVEDVRELRERIHLAPLSAPRKVFI
LDEAHMLSKSAFNALLKTLEEPPPHVLFVFATTEPERMPPTILSRTQHFRFRRLTEEEIA
FKLRRILEAVGREAEEEALLLLARLADGALRDAESLLERFLLLEGPLTRKEVERALGLPP
REALAEIAASLARGKTAEALGLARRLYGEGYAPRSLVSGLLEVFREGLYAAFGLAGTPLP
APPQALIAAMTALDEAMERLARRSDALSLEVALLEAGRALAAEALPQPTGAPSPEVGPKP
ESPPAPEPPRPEEAPDLRERWRAFLEALRPTLRAFVREARPEVREGQLCLAFPEDKAFHY
RKASEQKARLLPLAQAHFGVEEVVLVLEGEKKSLSPRPRPAPPPEAPAPPGPPEEEVEAE
EAAEEAPEEALRRVVRLLGGRVLWVRRPRTREAPEEEPLSQDEIGGTGI
NT seq 1590 nt   +upstreamnt  +downstreamnt
gtgagcgccctctaccgccgcttccgccccctcaccttccaggaggtggtggggcaggag
cacgtgaaggagcccctcctcaaggccatccgggaggggaggctcgcccaggcctacctc
ttctccgggcccaggggcgtgggcaagaccaccacggcgaggctcctcgccatggcggtg
gggtgccagggggaagaccccccttgcggggtctgcccccactgccaggcggtgcagagg
ggcgcccacccggacgtggtggagattgacgccgccagcaacaactccgtggaggacgtg
cgggagctgagggaaaggatccacctcgcccccctctctgcccccaggaaggtcttcatc
ctggacgaggcccacatgctctccaaaagcgccttcaacgccctcctcaagaccctggag
gagcccccgccccacgtcctcttcgtcttcgccaccaccgagcccgagaggatgcccccc
accatcctctcccgcacccagcacttccgcttccgccgcctcacggaggaggagatcgcc
tttaagctccggcgcatcctggaggccgtggggcgggaggcggaggaggaggccctcctc
ctcctcgcccgcctggcggacggggcccttagggacgcggaaagcctcctggagcgcttc
ctcctcctggaaggccccctcacccggaaggaggtggagcgcgccctaggcctccccccc
agggaggccctggccgagatcgccgcctccctcgcgagggggaaaacggcggaggccctg
ggcctcgcccggcgcctctacggggaagggtacgccccgaggagcctggtctcgggcctt
ttggaggtgttccgggaaggcctctacgccgccttcggcctcgcgggaaccccccttccc
gccccgccccaggccctgatcgccgccatgaccgccctggacgaggccatggagcgcctc
gcccgccgctccgacgccttaagcctggaggtggccctcctggaggcgggaagggccctg
gccgccgaggccctgccccagcccacgggcgctccctccccagaggtcggccccaagccg
gaaagccccccggccccggaacccccaaggcccgaggaggcgcccgacctgcgggagcgg
tggcgggccttcctcgaggccctcaggcccaccctacgggccttcgtgcgggaggcccgc
ccggaggtccgggaaggccagctctgcctcgctttccccgaggacaaggccttccactac
cgcaaggcctcggaacagaaggcgaggctcctccccctggcccaggcccatttcggggtg
gaggaggtcgtcctcgtcctggagggagaaaaaaaaagcctgagcccaaggccccgcccg
gccccacctcctgaagcgcccgcacccccgggccctcccgaggaggaggtagaggcggag
gaagcggcggaggaggccccggaggaggccttgaggcgggtggtccgcctcctggggggg
cgggtgctctgggtgcggcggcccaggacccgggaggcgccggaggaggaacccctgagc
caagacgagatagggggtactggtatataa

DBGET integrated database retrieval system