KEGG   Thermus thermophilus HB8: TTHA1957Help
Entry
TTHA1957          CDS       T00220                                 

Definition
(RefSeq) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 FAD_binding_3 Thi4 Pyr_redox_2 GIDA Pyr_redox FAD_oxidored MCRA Pyr_redox_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 3169700
NCBI-ProteinID: YP_145223
UniProt: O33850 Q5SGX3
Position
complement(1833813..1834280)
Genome map
AA seq 155 aa AA seqDB search
MAPLFPRGYRLGVRWARTRKEALGMERRVEALVVGGGLAGLSAAYFLARRGLRPWVLERE
APLSCTSDKSTEAYRLFWPGDEDLAALVRESLDLLSPFAGVARPNRRGYLYVGRLEALAA
WALGEEAPAWARAFAPGRFLDPAYRPKEGAARFQL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcacccctcttcccaagaggataccgcctcggtgtacgatgggcgcgaacccggaag
gaggctttgggcatggagcggcgcgtggaggctttggtggtgggcgggggccttgccggc
ctttccgccgcctactttttggcgcgaagggggctcaggccctgggtgctggagcgggag
gcccccctttcctgcaccagcgacaagtccacggaggcctaccgcctcttctggcccggg
gacgaggacctggccgccttggtccgggagagcctggacctcctttcgcccttcgccggg
gtggcccgccctaaccggcgggggtacctgtacgtgggccgcctcgaggccctggcggcc
tgggccctgggggaggaggcccccgcctgggcccgggccttcgcccccgggcgcttcctg
gacccggcttaccgcccgaaggaaggggcggcccggttccagctttag

DBGET integrated database retrieval system