KEGG   Thermus thermophilus HB8: TTHA1968
Entry
TTHA1968          CDS       T00220                                 

Symbol
TTHA1968
Name
(GenBank) competence protein ComEC
  KO
K02238  competence protein ComEC
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ttj02044]
    TTHA1968 (TTHA1968)
Secretion system [BR:ttj02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   TTHA1968 (TTHA1968)
SSDB
Motif
Pfam: Competence DUF4131 Lactamase_B DUF498 Lactamase_B_2 DUF2593
Other DBs
NCBI-ProteinID: BAD71791
UniProt: Q5SGW2
Position
1:1842023..1844056
AA seq 677 aa
MRPSWTWGVGLGAGALVAAWGLFAPWAFLGLGLLPFLRLPFALGFGLVLARALLFPLPEP
PWGAAVEGVFAVRGGFTRAEGHLLWVSHYPPLPDGRYRLRGRIAPPQGRTNPGGFDQRAW
LLSRGAKGVLRAESAEPLGPLPDWREGFRERLGAGLSLEAREVVEGLVLGDKGGLETAYP
LFQRAGLAHLLALSGLHVGVLVGFAVLGLYPLGRWRYLLALALLPFYLLLAGPSPSLVRA
SLMAGLSLLGLFLGLGGAGVVQALGLALFLQLLLRPEALLGLGFQLSYLAVLGLALVLPA
LRLPPGPRGYLLGGVAASLAVQAFLLPLLLHRFGFAPLLAPLANLLALPLVALLVPLGFL
KLFLGALPAPLVEPLARGLLLLAGLAAQGPLLRWGEIAPPGFALYYLGLLPLLFALHRRL
PWRRALLLASLPTLVGLLAARPKPLDLWMLDVGQGDALLARMGGGEVLVDGGRAEKGEAV
VRALRALGVEALELLVATHPDADHYGGLFRVIEEVPVGLALLAPGFPEDHPLAQALRARG
VPVVRAGAGTRLKVGQGEVRVLWPEALSGDDNQDGLALLLDFGRGRALLLADLPREVEAR
LPVGEVEALKVSHHGSQSGTSEVLLERTRPRVALIGVGPNPFGHPHPEVLERLERHGAEV
RRTDQDGAVRVLFGYAW
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgaggccttcttggacctggggagtggggcttggggcgggggctttggtggccgcctgg
gggcttttcgcgccttgggccttccttgggctcggcctccttcccttcctccgccttccc
ttcgccctgggcttcggcctcgtcctggcccgggccctcctcttccccttgcccgagccc
ccgtggggcgccgccgtggagggggtcttcgccgtgaggggcgggttcacacgggcggag
ggccacctcctctgggtgagccactatccccctctaccggacggccgctaccgcctccgg
gggcgcatcgccccgccccaaggccggaccaaccccggggggtttgaccaacgggcctgg
ctcctgagccggggggccaagggggtgctccgggccgaaagcgccgagcccttggggccc
ctgcccgactggagggaggggttccgggaacgcctaggggcgggcctgagcctcgaggcc
cgggaggtggtggagggcctggtcctcggggacaaggggggcttagagacggcctacccc
ctcttccagcgggcgggcctcgcccacctcctggcgctctctggccttcacgtgggggtg
ctcgtgggcttcgccgtcctcggcctctaccccctggggcggtggcgctacctcctggcc
ctcgccctcctccccttctacctcctcctcgccgggccgagcccctccctggtgcgggcg
agcctcatggcgggcctgtccctcctcggcctcttcctgggccttgggggggccggggtg
gtccaggccctggggctcgccctcttcctccagctcctcctccgccccgaggccctcctc
ggcctcgggttccagctctcctacctcgcggtgctgggcctggccctggtcctcccggcc
ctgaggcttcccccgggccccaggggctatctcctcgggggcgtggccgcaagcctggcc
gtccaggccttcctcctccccctcctcctccaccgcttcggcttcgcccccctcctcgcc
cccctcgccaacctcctcgccctccccctggtggccctcctcgtgcccctcggcttcctc
aagctcttcctcggcgccctccccgcccccctggtggagcccctcgcccgggggctcctc
ctcctggcggggcttgcggcccaagggcccctcctccgctggggggagatcgccccccca
ggctttgccctctactacctgggccttctccccctccttttcgccctccaccgcaggctt
ccctggcggcgcgccctcctcctcgcctccctgcccaccctggtgggcctcctcgccgcc
cggccaaagccgctggacctctggatgctggacgtgggccagggggacgccctcctcgcc
cgcatggggggcggggaggtcctggtggacgggggacgggcggagaagggggaggcggtg
gtccgggccctccgcgccctcggggtggaggccctggagcttttggtggccacccacccc
gacgcggaccactacggggggcttttccgggtgatagaggaggttcccgtgggccttgcc
ctcctcgcccccggcttccccgaggaccaccccctggcccaggccctaagggcgcggggc
gtccccgtggtgcgggccggggcgggaacccgccttaaggtgggccagggcgaggtccgg
gtgctctggcccgaggccctctccggggacgacaaccaagacggcctcgccctcctcctg
gacttcggccggggacgggccctcctcctcgccgacctgccccgggaggtggaggccagg
cttcccgtgggggaggtggaggcgctcaaggtgagccaccacggctcccaaagcggcacc
tccgaggtcctcctggaaaggacgaggccccgggtggccctcatcggggtggggcccaac
cccttcggccacccccaccccgaggtcctggagcgccttgagcgccacggcgcggaggtg
cgccgcaccgaccaggacggggcggtgcgcgtcctcttcggctacgcctggtag

DBGET integrated database retrieval system