KEGG   Thermus thermophilus HB8: TTHA1971Help
Entry
TTHA1971          CDS       T00220                                 

Gene name
gidB
Definition
(RefSeq) 16S rRNA methyltransferase GidB
  KO
K03501  16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ttj03009]
    TTHA1971 (gidB)
   03036 Chromosome and associated proteins [BR:ttj03036]
    TTHA1971 (gidB)
Enzymes [BR:ttj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     TTHA1971 (gidB)
Ribosome biogenesis [BR:ttj03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    TTHA1971 (gidB)
Chromosome and associated proteins [BR:ttj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    TTHA1971 (gidB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GidB MTS Methyltransf_31 Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 3169844
NCBI-ProteinID: YP_145237
UniProt: Q9LCY2
Structure
PDB: 

Position
complement(1845580..1846329)
Genome map
AA seq 249 aa AA seqDB search
MFHGKHPGGLSERGRALLLEGGKALGLDLKPHLEAFSRLYALLQEASGKVNLTALRGEEE
VVVKHFLDSLTLLRLPLWQGPLRVLDLGTGAGFPGLPLKIVRPELELVLVDATRKKVAFV
ERAIEVLGLKGARALWGRAEVLAREAGHREAYARAVARAVAPLCVLSELLLPFLEVGGAA
VAMKGPRVEEELAPLPPALERLGGRLGEVLALQLPLSGEARHLVVLEKTAPTPPAYPRRP
GVPERHPLC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacgggaaacacccggggggcctgagcgaaaggggccgggccctgctcttggag
gggggaaaggccttgggcctggacctaaagccccacctggaggccttctcccgcctctac
gccctcctccaggaggcgagcgggaaggtcaacctcaccgccctccgcggtgaggaggag
gtggtggtcaagcacttcctggactccctgactctcctcaggcttcccctctggcagggg
cccctacgggtcctggacctggggacgggggcggggtttcccggccttcccttgaagatc
gtccgccccgagctggagctcgtcctcgtggacgccacccggaagaaggtggccttcgtg
gagcgggccatagaggtccttgggctcaagggggcccgggccctctggggccgggcggag
gtcctcgcccgggaggcgggccaccgggaggcctacgcccgggcggtggcccgggccgtg
gcccctctctgcgtcctctccgagctccttttgcccttcctcgaggtgggcggggcggcg
gtagccatgaaggggccccgggtggaggaggagctcgcccccctgccccccgctctggag
cggctcggcgggcggcttggggaggtcctcgccctccagcttcccctctccggggaggcg
cgccacctggtggtgttggagaagaccgcccccaccccccccgcctacccccggcgccct
ggggttcccgagcggcatccgttatgctaa

DBGET integrated database retrieval system