KEGG   Thermus thermophilus HB8: TTHB147
Entry
TTHB147           CDS       T00220                                 
Symbol
TTHB147
Name
(GenBank) conserved hypothetical protein
  KO
K07016  CRISPR-associated protein Csm1
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB147 (TTHB147)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Type III signiture cas proteins
    TTHB147 (TTHB147)
SSDB
Motif
Pfam: Csm1_B HD
Other DBs
NCBI-ProteinID: BAD71943
UniProt: Q53W19
Position
pTT27:136457..138874
AA seq 805 aa
MLGDGLSVALAGLLHDVGKLYSRARWGERDDQVPDRTHTAYTAHFVREHAGLFRGAGLDP
DWLARTASRHHEGWRDRPQYRPETPEEWCVALADTYASKEREEGEGGGSPPEVPLSPPFR
RLLLGGEEGREGGYSPVGAGGRVGLEAGGLYPEERPNVSKDVYKRLLERLEGRLEEMARF
SLGKEALVLNLALALQETLSLVPSDTQSEPDVSLYDHLRLTAAIAHALWLFHGGSPSAQN
LRQDGEKFLLVVGDMGGIQGHIYRIAGAEAGVGGIAKRLRARSLEVSLAAEAMALGLLWR
LGLTSLNRILGAGGKFYLLLPNTEEARAALEGTREAWGRWALKRGGSLVPHLAWVAFRGQ
DFRDFAALLKRLHEALAREKLRPFAFLASTGGVLGAPLRPCAACGLEPARRDEPGSLCPD
CEREAALGARLPRSDRVGFFLEEAPRPYLDFPGLKVGLGGPLEGAFHLFRARLDFAPWPD
PSEAKPLLGHLPRVEHALKAKGWSLEAYRAWAEEEGLLEDEEPHPEKVLTFAELAALSEG
APYLGALMLDADRMGEAFATGFRREGRDLATPSRLAALSRTLEVFFTTEVLTLLEEPRRY
RERLGWDDLEAQRKEARYPLLYSVYSGGDDLFLLGPWDALLDFALDLERLYRLFTRHPRL
TLSGGFLLVPPSLPVPELARLLGEAEKRAKAEGRERLFLFGQAVPWETLRGLRAWAEGLR
QDLRAERVSRAQVYRWLLLWRRFSPLEDPGERMRYKPLLAYALRRVRERDEEAWKRYLKL
LDHQDPAWAYLPVWVQWALYRERRV
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgcttggggacggcctgagcgtggccctggcgggacttttgcacgacgtgggcaagctc
tattcccgcgcccgctggggcgagcgggacgatcaggttcccgaccgcacccacaccgcc
tacactgcccacttcgtccgggagcatgccgggctctttcgcggggcgggcctggacccg
gactggctcgcccggacggcaagccgccaccacgagggctggcgggaccgcccccagtac
cggcccgagacccccgaggagtggtgcgtggccctggcggacacctacgcctccaaggag
cgggaggagggggagggtgggggaagccctccggaggtgcccctttcccctcccttccgc
aggctcctcctggggggcgaggaggggagggaaggagggtacagccccgtgggggccggg
gggcgggtgggcctcgaggccggggggctttacccggaggagcggcccaacgtctccaaa
gacgtctacaagcggcttcttgagcggctggaggggcggcttgaggagatggcccgcttc
tccctgggcaaggaggcccttgtcctgaacctggccctggccctccaggagaccctttcc
ctggtgccctcggacacccagtcggagccggacgtctccctctacgaccacctgcgcctc
acggcggccatcgcccacgccttgtggcttttccacgggggaagcccctcggcacagaac
ctgcgccaggacggggagaagttcctcctggtggtgggggacatggggggcatccagggg
cacatctaccgcatcgccggggcggaggcgggagtggggggcatcgccaagcggcttcgg
gcgaggagcctcgaggtgagcctggccgcggaggccatggccctggggcttctttggcgc
ctgggcctcacctccctgaaccgcatcttgggggcggggggcaagttctacctcctcctg
cccaacaccgaggaggcgagggcggccctggaggggaccagggaggcctgggggaggtgg
gccctcaagcgggggggaagcctcgtgccccacctggcctgggtggccttccgggggcag
gacttccgggacttcgccgcccttctcaagcgcctccacgaggccctcgcccgggagaag
ctcaggcccttcgccttcctcgcctccacggggggggtcctgggggcgcccctccgcccc
tgcgccgcctgcggcctggagcccgcccgaagggacgagcccggaagcctctgcccggac
tgcgagcgggaggcggccctcggggcccggcttccccgaagcgaccgggtgggcttcttc
ctggaagaggctccgaggccctacctggactttcccggcctgaaggtgggcctggggggg
ccgttggagggggccttccacctcttccgcgcccggctggacttcgccccctggcccgac
ccctcggaggccaagcccctcctcggccacctgccccgggtggagcacgccctgaaggcc
aaggggtggagcctggaggcctaccgggcctgggccgaggaggaggggcttttggaggac
gaggagccccatcccgaaaaggtcctcaccttcgccgaactcgccgccctctcggagggc
gccccctacctcggggccctcatgctggacgccgaccgcatgggggaggccttcgccaca
ggcttccgccgcgaggggcgggacctcgccaccccgagccgcctcgccgccctctcccgc
accctggaggtcttcttcaccacggaggtcctcaccctcctggaggagccccggcgctac
cgggagcggcttgggtgggacgacctcgaggcccagcgcaaggaggcccgctaccccctc
ctctacagcgtctactccgggggggacgacctcttcctcctcgggccctgggacgccctt
ttggacttcgccctggacctggagaggctctaccgcctcttcacccgccacccgcggctc
accctctccggggggttcctcctcgtcccgccgagcctccccgtgcccgagctcgcccgg
cttttgggggaggcggagaagcgggccaaggccgaggggcgggagaggcttttcctcttc
ggccaggcggtgccgtgggagaccttgcggggccttcgcgcctgggccgagggcctgcgc
caagacctgcgggccgagcgggtgagccgggcccaggtctaccgctggctcctcctctgg
cgcaggttctcccccctggaggaccccggggagcggatgcgctacaagcccctcttggcc
tacgccctaaggcgcgtccgggaacgggacgaggaggcgtggaagaggtatctaaagctt
cttgaccaccaggacccggcctgggcctaccttcccgtctgggtccagtgggcgctttac
cgggaaaggagggtgtga

DBGET integrated database retrieval system