KEGG   Thermus thermophilus HB8: TTHB148
Entry
TTHB148           CDS       T00220                                 
Symbol
TTHB148
Name
(GenBank) hypothetical protein
  KO
K19138  CRISPR-associated protein Csm2
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB148 (TTHB148)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Subtype III-A factors
    TTHB148 (TTHB148)
SSDB
Motif
Pfam: Csm2_III-A SF-assemblin
Other DBs
NCBI-ProteinID: BAD71944
UniProt: Q53WF6
Position
pTT27:138875..139279
AA seq 134 aa
MPALEFFKDKERGVLDPKVFERAREVAEGLARGKLKSSQFRNYFAELRALENRFERERRK
EGEELAFARLVPQLELLRAKLFYNTRSQGPLRDAKEFVEFMEEALEAGKRSPKDFEAMMK
YVEAVLAYFYALAK
NT seq 405 nt   +upstreamnt  +downstreamnt
atgccggcgttggagtttttcaaggacaaggagcggggagttctggaccccaaggtcttt
gagcgggcccgggaggtggcggaggggctcgccagggggaagctcaagtccagccagttc
cgcaactacttcgccgagctcagggccctggagaaccgctttgagcgggagaggcgcaag
gaaggggaggagttggccttcgcccggctcgtcccccagcttgagctcctcagggccaag
ctcttctacaacacccgctcccagggccccttgagggacgccaaggagttcgtggagttc
atggaggaggccctcgaggcggggaagcggagcccaaaggactttgaagcgatgatgaag
tacgtggaggcggtgctcgcctacttctacgccttggcgaagtag

DBGET integrated database retrieval system