KEGG   Thermus thermophilus HB8: TTHB149
Entry
TTHB149           CDS       T00220                                 
Symbol
TTHB149
Name
(GenBank) conserved hypothetical protein
  KO
K09002  CRISPR-associated protein Csm3
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB149 (TTHB149)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Subtype III-A factors
    TTHB149 (TTHB149)
SSDB
Motif
Pfam: RAMPs
Other DBs
NCBI-ProteinID: BAD71945
UniProt: Q53WF5
Position
pTT27:139291..140016
AA seq 241 aa
MKLKKVIRIRSVLLAKTGLRIGMSRDQMAIGDLDNPVVRNPLTDEPYIPGSSLKGKLRYL
LEWSLGGDYILKAKERQVYASPDPKDPVARIFGLAPENDERSLAVARERGPTRLLVRDAY
LTEDAKEALERTSARGGLYTEIKQEVFIPRLGGNANPRTTERVPAGARFRVEMTYRVLDD
LDEEYFGKYLLRALELLELDGLGGHISRGYGQVYFLHPERLTEDQEGWPLKERLKVEEVV
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagctcaagaaggtgatccgcatccgctcggtgctcctggccaagacgggcctcagg
atcgggatgagccgggaccagatggccatcggcgacctggacaaccccgtggttcgcaac
cccctcacggacgagccttacatccccggctccagcctcaaggggaagctccgctacctc
ctggagtggagcctgggcggggactacatcctgaaggccaaagaaaggcaggtctacgcc
tcccccgaccccaaggaccccgtggcccgcatcttcggcctggccccggagaacgacgag
aggtctttggcagtggcccgggagcggggccccacgaggctcctcgtgcgggacgcttac
ctcacggaggacgccaaggaggccttagagcgcacctccgccaggggcgggctctacacg
gagatcaagcaggaggtcttcatcccccgcctgggcggaaacgccaacccccgcaccacg
gaaagggttcccgccggggcccgctttagggtggagatgacctaccgggtgctggacgac
ctggacgaggagtacttcgggaaatacctcctccgggccctggagcttctggagctggac
ggcctcggggggcacatcagccggggctacggccaggtctacttcctccaccccgaaagg
cttacggaggaccaggagggctggcccctaaaggaaaggctcaaggtggaggaagtggtc
ctttag

DBGET integrated database retrieval system