KEGG   Thermus thermophilus HB8: TTHB151
Entry
TTHB151           CDS       T00220                                 
Symbol
TTHB151
Name
(GenBank) conserved hypothetical protein
  KO
K19140  CRISPR-associated protein Csm5
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB151 (TTHB151)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Subtype III-A factors
    TTHB151 (TTHB151)
SSDB
Motif
Pfam: RAMPs
Other DBs
NCBI-ProteinID: BAD71947
UniProt: Q53W18
Position
pTT27:140859..142052
AA seq 397 aa
MGGPRGLSLGGEGMRFLRSFRLELEALSPVHVGTGEAYPAYAYVPDFARKAVHLLDPAAL
LLALPEARRRQYLEKVAQGPKAAQEVLRYLLEEDQLPREAVLHTLPASKAFLEALRSATE
EALLEYRPLPRSPLGAYLPGSSVKGALRTAWLFHVLVREGKVAVFDRKEGVWRLRAWREG
DGGTHVYPSRNPSLYENQAFEGAVLGYAREGKGRRMSLDLYRDPFRAVRLSDSGPVETFL
NRLGVFHPHKDTSRMVLLAETFRIGTRFALTLRYHEGLSRDGDGERGVSMPIPPEDLVRA
LRDYYGKVAEWEEGFAEEHRLKRALEVYRALRERLQDPEAFPLRVGFGSGRLALRLALLL
PEDHPEAQEPKTRKTAGAQNPVDGYPLGWMVGRLEPL
NT seq 1194 nt   +upstreamnt  +downstreamnt
gtgggaggccctcgtggtctttcccttgggggtgagggtatgaggttcctgaggagcttt
cgcctggagctggaggccctaagccccgtgcacgtgggcaccggggaggcctaccccgcc
tacgcctacgtgccggacttcgccaggaaggcggtccacctcctggaccccgcggccctc
ctcctcgccctccccgaggctaggcgccgccagtacctggagaaggtggcccagggcccc
aaggcggcccaggaggtcctgcgctatctcctggaagaagaccagcttccccgggaggcc
gtcctccacaccctccccgccagcaaggcctttttggaagcccttcgctccgccacggag
gaggccctcctggagtaccgcccccttccccgttcccccctgggggcctacctccccggt
tccagcgtcaagggggccttgcgcaccgcctggctcttccacgtcctggtgagggagggc
aaggtggcggtctttgaccggaaggagggggtgtggcggctcagggcctggcgggagggg
gacgggggcacccacgtctacccctcccggaaccccagcctttacgagaaccaggccttt
gagggcgcggtcctgggctacgcccgcgaggggaaagggaggcggatgtccttggacctc
taccgcgaccccttccgggcggtgcgcctttcggactcggggccggtggagaccttcttg
aaccgcctcggggtcttccaccctcacaaggacacctcgaggatggtcctcttggcggag
accttccgcataggcacccgcttcgccctcaccctccgctaccacgagggccttagccgg
gacggggatggggagcggggggtgtccatgcccattcccccggaggacttggtccgggcc
ctcagggactactacgggaaggtggcggagtgggaggagggcttcgccgaggagcacagg
cttaagcgggccctggaggtctaccgggccctaagggagcggcttcaggacccggaggcc
ttccccctccgggtgggctttggctcggggaggctcgccctgcgcctcgccctcctcctt
cccgaggaccaccccgaggcccaggagcccaagacccggaagaccgcgggggcccagaac
cctgtggacggctaccccttaggctggatggtggggaggctagagcccctctag

DBGET integrated database retrieval system