KEGG   Thermus thermophilus HB8: TTHB160
Entry
TTHB160           CDS       T00220                                 
Symbol
TTHB160
Name
(GenBank) conserved hypothetical protein
  KO
K19076  CRISPR-associated protein Cmr2
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB160 (TTHB160)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Subtype III-B factors
    TTHB160 (TTHB160)
SSDB
Motif
Pfam: Cmr2_N mCpol TetR_C_28
Other DBs
NCBI-ProteinID: BAD71956
UniProt: Q53W09
Position
pTT27:151610..153364
AA seq 584 aa
MEHLLAIALGPVQEFIATARRTRDLYAGSRLLSEAAARAAKALAREVGAKNLIFPAPEDE
AGLERLAGAGIPNVLLVRVPEGKDPRGLGEQALGAARDYLRERAEEVLGPRRDLLFWREA
LAQVEDLLEGYYAYLPLEGDYPRARERLMALLAARKNTRDFAPVSWGSPAYKSSLDGARE
SVLRLPEKEADHLRVRLGLRPGEYLAGPDLLKRWWKAGHGFLSTTHMAALPFWEGVRRAG
LEAVLKEALEELGGLVGEEARAEVRHPVLRDTPFGEWDVRLLYESRLEEFPSLAEDPGLL
EKARDRLRALWRRLFPKVRVPPGAYYALLHADGDRMGETLDGLPSPEAHRRFSNALALGF
AAQVKDIVEAHGGGLVYSGGDDVLALLPLHTALMAARALADRFREAMAPFGREGRAPSLS
VGLAVVHHLEPLQDALDLARRAEKWAKEGEPKRNALCVAYSPRSGAERLVRGRWDENPPL
TRRLLRYADLLRAGEVPSRAAYELLALVREAGEALSGEALVAEALRILGRKEMKRAYREE
LEAWLRTGEDVRRLAEELILARPFAEALDQAGVPVESREVWDAH
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggagcaccttctcgctatcgccctgggcccggtgcaggagttcatcgccaccgcccgc
aggacccgggacctctacgcgggaagccgcctcctctccgaggcggccgcccgcgccgcc
aaggccctggcccgggaggtgggggcgaaaaacctcattttccccgcccccgaggacgag
gcggggctggagcggctggccggggcgggcatccccaacgttcttttggtccgggttccg
gaggggaaggaccccaggggcctcggggaacaagccttgggagccgcccgggactacctc
cgggagagggcggaggaagttctggggccgcgtagggacctccttttctggagggaggcc
ctggcccaggtggaagacctcctggagggctactacgcctaccttcccttggagggcgac
tatccccgggcccgggagcggctcatggccctcctggccgcccgcaaaaacacccgggac
ttcgcccccgtctcctggggaagcccggcctacaagagctccctggacggggcccgggag
agcgtcctccgcctgcccgaaaaggaggcggaccacctcagggtgcggctcggcctgcgc
cccggggagtacctcgcggggcccgacctcctcaagcgctggtggaaggcggggcacggc
ttccttagcaccacccacatggcggccctgcccttctgggagggggtcaggcgggcgggc
ctggaggcggtcctaaaggaggccctggaggagcttgggggcctcgtgggggaggaggcg
cgggcggaggtccgccacccggttttgcgggacacccccttcggggagtgggacgtgcgc
ctcctctacgagagccgcctcgaggagtttccctccctcgccgaggaccccgggcttctg
gagaaggcgcgggaccgcctgagggcgctttggcggaggcttttccccaaggtgagggtt
cccccgggcgcctactacgccctcctccacgccgacggggaccggatgggggagaccctg
gacggccttccgtcccccgaggcccaccgccgcttctccaacgccctggccctggggttc
gccgcccaggtcaaggacatcgtggaggcccacgggggcgggctcgtctactcggggggg
gacgacgtcttggccctgcttcccctccacacggccctcatggccgcccgggccctggcg
gaccgcttccgggaggccatggcccccttcggccgggagggccgggcgccgagcctctcc
gtgggcctcgcggtggtccaccacctggagcctctgcaggacgccctggacctggcccgc
cgggcggagaaatgggcgaaggagggcgagcccaagcgcaacgccctctgcgtggcctac
agcccccgctcgggggcggagcgcctggtccggggccggtgggacgagaaccctcccctc
acccgccgcctcctccgctacgccgacctcctgcgggcgggggaggtgccctccagggcc
gcctacgagcttctggccctggtccgggaagcgggggaggccctctccggggaggccctg
gtggccgaggccctgcggatcctggggaggaaggagatgaagcgggcctaccgggaggag
ctcgaggcctggctccggaccggggaggacgtgcgccgcctggcggaggagctcatcctc
gcccggcccttcgccgaggccctggaccaggcgggcgtgcccgtggagagccgggaggtg
tgggatgctcattga

DBGET integrated database retrieval system