KEGG   Thermus thermophilus HB8: TTHB162
Entry
TTHB162           CDS       T00220                                 
Symbol
TTHB162
Name
(GenBank) conserved hypothetical protein
  KO
K07061  CRISPR-associated protein Cmr1
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB162 (TTHB162)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Subtype III-B factors
    TTHB162 (TTHB162)
SSDB
Motif
Pfam: RAMPs MciZ
Other DBs
NCBI-ProteinID: BAD71958
UniProt: Q53W07
Position
pTT27:154436..155623
AA seq 395 aa
MRRAFREAFSPRRKEEGGVLVRRDGARVLAWERTYTLLTPLFGGGVEPREADPVSVVRAT
AVRGHLRFWWRAVRGWRAGGSLERLWELESALFGSAGEGGASPLSVEVEVLREGEKVGIA
QYGRAVQWYLGFPLRGDKEWAPVKEGVAFRLRLRFPEKVGELNFWEELEAALWAWETFGG
IGARTRRGFGALLPQGAGVPGEEEIREKLRQYGQKAGWPEGVPHLTPKSFVRVVPLSWRE
LAERYQAFRQARPGGDPRSPGRSYWPEPDGVRRLTGRHAPHHLPRHPVHKFPRAHFGLPI
IFHFKDRGDPPDTTLRLKEADRRASPLLFRPLGEGQKPCVVAVLEGARFPGEKLVLEGKD
GRTWDVDPWLTPEEAQKIPVLGGEVDPVLAFVKSL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgagaagggcgtttcgtgaggcgttctcgccgaggcgaaaggaggagggaggggtcctg
gtgcgccgggacggcgcgcgggtcctcgcctgggagcgcacgtacacgctcctcaccccc
ctcttcgggggcggggtggagcctagggaggcggatccggtgagcgtggtccgggccacg
gcggtccgggggcacctccgcttctggtggcgggccgtgaggggctggcgggcggggggt
tcgctggagaggctttgggagctggagtccgccttgtttggcagcgcgggggagggcggg
gcctcgcccttgagcgtggaggtggaggttctaagggaaggggaaaaggtaggcatcgcc
cagtacggccgcgcagtccagtggtacctgggctttcctctacgcggggacaaggaatgg
gccccggtcaaggagggcgtggccttccgcctccgcctccgctttcccgaaaaggtgggg
gagctgaacttctgggaggagctcgaggccgccctctgggcctgggagaccttcgggggg
atcggggcccggacccggaggggctttggcgccctcctgccccagggggccggggtgccg
ggggaggaggagatccgagagaagcttcgccagtatggccaaaaagcagggtggcccgaa
ggggtgccccacctcaccccaaaaagcttcgtgcgggtggtgcccctctcctggagagaa
ctcgccgagcgctaccaggccttccgccaggcccgccccgggggggaccccagaagcccg
ggccgctcctactggcccgagcccgacggggtgcggcgcctcacggggcggcacgccccc
caccacctgcccaggcaccccgtgcacaagttcccccgggcccacttcggcctgcccatc
atcttccacttcaaggacaggggcgacccccccgacaccaccctccggctcaaggaggcc
gaccgccgggcgagccccctcctcttccgcccgcttggggaagggcagaagccctgcgtg
gtggcggtcctcgagggggccaggttccctggggaaaagcttgttttggagggcaaagac
ggccgcacttgggacgtggacccctggctcacccccgaggaggcccaaaagatcccggtg
ctggggggtgaggtggaccccgtcttggccttcgtgaaaagcttgtag

DBGET integrated database retrieval system