KEGG   Thermus thermophilus HB8: TTHB164
Entry
TTHB164           CDS       T00220                                 
Symbol
TTHB164
Name
(GenBank) conserved hypothetical protein
  KO
K19141  CRISPR-associated protein Cmr5
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB164 (TTHB164)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Subtype III-B factors
    TTHB164 (TTHB164)
SSDB
Motif
Pfam: Cas_Cmr5
Other DBs
NCBI-ProteinID: BAD71960
UniProt: Q53W05
Structure
Position
pTT27:156503..156847
AA seq 114 aa
MRTRSQVWAQKAYEKVREAAKGEGRGEYRDMALKLPVLVRQAGLSQALAFVDSRGKEAHK
ALGNDLAQVLGYRDLRELAEAAREAELLQYLRLTREVLAAAEWFKRFAQALIEE
NT seq 345 nt   +upstreamnt  +downstreamnt
gtgcgcacccgctcgcaggtgtgggcccagaaggcctacgagaaggtccgggaagcggcc
aagggcgagggccggggcgagtaccgggacatggccctaaagcttcccgtcctggtgcgc
caggcggggctttcccaggccctggccttcgtggactcccgggggaaggaggctcacaag
gccctgggtaacgacctggcccaggtgctgggctaccgggacctccgggagctggcggag
gccgcccgggaggccgagctcctccagtacctccgcctcacccgggaggtcctggccgcg
gcggagtggttcaagcgcttcgcccaggccctcattgaggagtag

DBGET integrated database retrieval system