KEGG   Thermus thermophilus HB8: TTHB165
Entry
TTHB165           CDS       T00220                                 
Symbol
TTHB165
Name
(GenBank) conserved hypothetical protein
  KO
K19142  CRISPR-associated protein Cmr6
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB165 (TTHB165)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type III CRISPR-Cas system
   Subtype III-B factors
    TTHB165 (TTHB165)
SSDB
Motif
Pfam: RAMPs
Other DBs
NCBI-ProteinID: BAD71961
UniProt: Q53W04
Position
pTT27:156850..157896
AA seq 348 aa
MGRRSALEGVRLPQGKEPHRGLWLDKFLRSARREDTEAKRVLVREAAGIPEPGEYRAFFK
RYRGALEALGAEIREARTLSRLVVGLGGEGVLETALTLHRAYGVPYIPGSALKGLASRYA
HLYLEGEAWRRDLARFHRGEAQAGLFGTTEEQGLVVFWDALPLPGKWKLHPDILNPHHPD
YYGSVKAPPADWDGPKPVPFLSATGTFLLALSPAPGVSPEEAGPWLRAAWRILAWALREE
GVGAKTSSGYGRMALEEPASQGEKPLAPGPSPVLQDLLTWARALSYREVPRFLASQAEAI
LGLSVEEAQALRRALEERGFLRNPQDLKRWRKEHPGLEGVLAKLGLSA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggccgcagatccgcgcttgagggcgtccgcctcccccaaggcaaggagccccaccgg
ggcctctggctggacaagttcttgaggtcggcgaggcgggaggacaccgaggccaagcgg
gttctcgtccgggaagcggcggggatccccgagcccggggagtaccgggcgttttttaag
cggtaccgcggggccctcgaggccctgggggccgaaatccgtgaggccaggaccctctcc
cgcctggtggtgggcctgggtggggaaggcgtgctggagacggccctcaccctgcaccgc
gcctacggggtgccctacatcccgggctcggccctgaagggcctggcgagccgctacgcc
cacctctacctggagggcgaggcctggcggcgcgacctcgcccgcttccaccggggcgag
gcccaggcggggcttttcggcaccacggaggagcagggcctcgtggtcttctgggatgcc
ctcccccttcccgggaaatggaagctccaccccgacattctgaacccccaccaccctgac
tactatgggagcgtcaaagcgccccccgcggactgggacggccccaagccggtccccttc
ctctccgccacgggcaccttcctcctcgccctctccccggcccccggggtttctcccgag
gaggccgggccctggcttcgggccgcctggcgcatcctggcctgggccctgcgggaggag
ggggtgggggccaagacctcctcggggtacgggcgcatggccctggaggagcctgcgtcc
caaggggaaaagcccctggcgccggggccgagcccggtccttcaggacctcctcacctgg
gcccgcgccctctcctacagggaggtgccccgtttcctggcttcccaggcggaggccatc
ctgggcctctcggtggaggaggcccaggcccttcgccgggccctggaggagcggggcttc
ctccgcaacccccaggacctgaagcgctggcgcaaggagcatcccggcctggaaggggtt
ctcgccaagctgggcctctcggcctag

DBGET integrated database retrieval system