KEGG   Thermus thermophilus HB8: TTHB225
Entry
TTHB225           CDS       T00220                                 
Symbol
TTHB225
Name
(GenBank) conserved hypothetical protein
  KO
K07464  CRISPR-associated exonuclease Cas4 [EC:3.1.12.1]
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHB225 (TTHB225)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.1  5' to 3' exodeoxyribonuclease (nucleoside 3'-phosphate-forming)
     TTHB225 (TTHB225)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-A factors
    TTHB225 (TTHB225)
   Subtype I-B factors
    TTHB225 (TTHB225)
   Subtype I-C factors
    TTHB225 (TTHB225)
   Subtype I-D factors
    TTHB225 (TTHB225)
  Type II CRISPR-Cas system
   Subtype II-B factors
    TTHB225 (TTHB225)
SSDB
Motif
Pfam: Cas_Cas4 PDDEXK_1
Other DBs
NCBI-ProteinID: BAD72021
UniProt: Q53VV4
Position
pTT27:complement(229726..230310)
AA seq 194 aa
MGHGGAVEYLPLSKVNTVVYCPRRFYLEYVLGEAHANHHLIEGHYLHERAYTEPGEESGL
WVWSDRLGLLGVVDRLEWRRGEACPVEYKLGRAKEEAYLSDAVQLAAQALCLRESRGIKA
RRGFVYYHKSHTRREVVFTPELFRAVEAAVVRMRALLQSPRPPRVEVPPSKCEGCSVRGA
CQPELWRKGVAGWA
NT seq 585 nt   +upstreamnt  +downstreamnt
atgggccatgggggagccgtggaatacctgcccctctccaaggtgaacacggtggtctac
tgcccccggcgcttctatctggagtacgtcctgggggaagcgcacgccaaccaccacctg
attgagggccactacctccacgaaagggcctacaccgagccgggggaggagagcgggctt
tgggtgtggtcggaccggcttgggcttcttggagtggtggatcggctggagtggcggcgg
ggggaggcctgccccgtggagtacaagctgggccgggccaaggaagaggcctacctctcc
gatgccgtgcagcttgccgctcaggccctttgtctccgggaatccagagggatcaaggcc
cggaggggattcgtttactaccacaaaagccacacccgccgggaagtggttttcacccca
gagctctttcgcgccgtggaggcggctgtagtccgaatgcgggcccttctccaaagccct
cgccccccaagggtagaggttcccccctccaagtgcgaggggtgtagcgtacggggcgcc
tgccagcccgagctgtggcggaagggggtggcggggtgggcgtag

DBGET integrated database retrieval system