KEGG   Thermosulfidibacter takaii: TST_0093Help
Entry
TST_0093          CDS       T04192                                 

Definition
(GenBank) inorganic phosphate transporter, PiT family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ttk  Thermosulfidibacter takaii
Brite
KEGG Orthology (KO) [BR:ttk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TST_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: BAT70903
UniProt: A0A0S3QRF7
Position
complement(92196..93434)
Genome map
AA seq 412 aa AA seqDB search
MNMYIIGGIALLAGMYMAWNIGANDVANAMGTSVGSKAITLKKAIIIAAIFEFSGAFFVG
SHVTSTISKGIVDPMLFQDNPNLFILGMLAALISAGIWVQLATYLGLPVSTTHSIVGAVV
GFGIVSKGLSAIEWGKMVSIVLSWIISPIAGGLIAFLMFRWITKNILATEYPAKATRKYG
PYLVSMVVFIIALSIVYKGLKLHLPLFKAVLLALVIAFIFGTAFKFLVFSSAKSSGETIR
QRLYETEELFKYLQLATACYMAFAHGANDVANATGPMAGIITTMAKGVVVAKAYVPDWVL
LLGGLGIVMGLATWGYKVIETIGGRITDITPSRGFCAEFGCATTVLVCSKMGLPISTTHT
LVGSVIGVGFARGIGALNMRTIKQIVNSWIITVPFTAGLCVFIYAILKALFI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtacatcataggcggtatagcgctcttagcaggtatgtacatggcttggaac
attggcgccaacgatgtggccaatgccatgggcacatctgttggttccaaggccatcacc
ttgaaaaaggccattattatagcggccatctttgagttctcaggagctttctttgtggga
agccacgtgacctccaccataagcaagggcatagtggatcctatgctatttcaggataac
cccaacctctttatcctgggtatgctggcggcattaatatccgcagggatatgggtgcag
cttgccacctacctcggcctgcccgtatccacaacccactccatagtgggtgcagtggta
ggctttggtatagttagcaaagggctttcagccattgaatggggcaaaatggtttccata
gtgctttcctggattatctctcctatagcaggaggattgatagccttccttatgtttagg
tggataacgaaaaacatcctggccacagaatatcccgcaaaagcaactaggaaatacggc
ccatatcttgtaagcatggtggtatttattatagccttatccattgtttacaaagggtta
aaactacatttgccccttttcaaagctgtacttttagcattagtcatagcttttatcttc
ggcacagcctttaaatttttagtattcagttccgccaaaagctctggagaaacaatcaga
caaaggctttatgaaactgaagagctatttaaatacttgcagcttgccactgcctgctat
atggcctttgcgcacggagccaatgatgttgcaaatgccacaggccccatggctggaata
ataaccaccatggccaaaggagtggtagtggcaaaagcctatgttccagactgggtatta
ctccttggaggcttgggtatagtcatggggttagctacctggggatacaaagttatagaa
accatcggtggaagaatcactgacatcaccccctctagaggtttctgtgcagagtttgga
tgtgccaccacagtgcttgtgtgctcaaaaatgggtcttcccatctccacaacccacact
ctcgtgggctcagttataggagtgggctttgctcgaggcataggtgccttgaacatgagg
acaataaaacagatagtaaactcctggataataaccgtgcctttcaccgccggattgtgt
gtcttcatatacgccatacttaaggcactctttatatga

DBGET integrated database retrieval system