KEGG   Thermosulfidibacter takaii: TST_0179Help
Entry
TST_0179          CDS       T04192                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ttk  Thermosulfidibacter takaii
Pathway
ttk00010  Glycolysis / Gluconeogenesis
ttk00053  Ascorbate and aldarate metabolism
ttk00071  Fatty acid degradation
ttk00280  Valine, leucine and isoleucine degradation
ttk00310  Lysine degradation
ttk00330  Arginine and proline metabolism
ttk00340  Histidine metabolism
ttk00380  Tryptophan metabolism
ttk00410  beta-Alanine metabolism
ttk00561  Glycerolipid metabolism
ttk00620  Pyruvate metabolism
ttk00625  Chloroalkane and chloroalkene degradation
ttk01100  Metabolic pathways
ttk01110  Biosynthesis of secondary metabolites
ttk01120  Microbial metabolism in diverse environments
ttk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TST_0179
   00053 Ascorbate and aldarate metabolism
    TST_0179
   00620 Pyruvate metabolism
    TST_0179
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TST_0179
   00561 Glycerolipid metabolism
    TST_0179
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TST_0179
   00310 Lysine degradation
    TST_0179
   00330 Arginine and proline metabolism
    TST_0179
   00340 Histidine metabolism
    TST_0179
   00380 Tryptophan metabolism
    TST_0179
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TST_0179
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TST_0179
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TST_0179
Enzymes [BR:ttk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TST_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAT70989
UniProt: A0A0S3QRS2
Position
181193..182587
Genome map
AA seq 464 aa AA seqDB search
MFTELVSAQRSFFLSGGTIDIEKRKKLLRDLKTVVKEHEESILDALKLDLGKPRFEAYVS
ELAHFYTEVDYAVSHLKRWSKKKRRLTPLVNCPGSSYTYRQPYGVVLIISPWNYPFNLAL
VPLIYAVAAGNTVVLKPSEVSENTSRIIAKVVDSVFDREHVAVVEGGPDVARALLEEKFD
LIFYTGNPVIGRYVMEKAAKHLTPVVLELGGKSPVVVWKEKNLDVSVKRIVWGKCFNAGQ
TCIAPDYVLLEKGLFDQFVSLFSKWLGKFYGESVKATPHYARIINKRHFMRLRTVLEAEK
DNIVLGGGWDEDALFIAPTLIKASPESPSMQDEIFGPILPVIEMESIEDMVNLINSRPEP
LALYLFTSDSHIKRLFMERIRSGALLYGDCLVHFVSPWLPFGGIGESGIGKYHGKWGFEA
FTNEKAIVDRPRVLDLPVRYPPYNKWKMSFIKRLGGFLTRFGVI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtttactgaactggtgtcggctcagagaagctttttcctttctggcggtactattgat
attgagaagaggaagaaacttctgagggatttaaaaacagttgtgaaggagcatgaagag
agcatacttgatgctttgaagcttgatttgggtaagccgcgctttgaggcttatgttagc
gagcttgcccatttttatacagaggtagactacgcagtttcccatctgaaaagatggagc
aaaaagaagagaaggcttacaccattggtgaactgccccggaagcagttatacctacaga
cagccctatggggtggtattaataatttccccatggaactatccttttaaccttgctctg
gttcccttaatctatgccgtggctgcggggaacaccgtggttttaaagccttctgaggtg
tccgaaaacacgagcagaattatagcgaaggttgtagattctgtttttgatagagagcat
gttgcggtagtggaaggtggtcctgatgtggcaagggctcttttggaagagaaatttgat
ctcattttctacacaggtaatcccgtaataggccggtatgttatggaaaaagcggccaag
catcttaccccggtggttttggagctgggtggtaaaagccccgtagtggtgtggaaagag
aagaatcttgatgtttctgtaaaaagaattgtctggggtaagtgctttaatgcaggccag
acgtgcatagcgccagactatgtacttttggaaaaggggttgtttgatcagtttgtttca
ctgttttccaaatggctgggcaagttttacggggaaagtgttaaagcgactcctcattac
gctcgtataattaataaaagacactttatgaggttgaggacggttcttgaggctgaaaag
gataatattgttcttggcggtgggtgggatgaggatgctttgttcattgcacctacttta
attaaggcaagtcctgaatctccttctatgcaggatgagatttttggtcctatacttcct
gttatagaaatggaaagtatcgaggatatggttaatcttataaacagccgtcctgagcca
cttgccctttaccttttcacttctgattcgcatatcaagaggctctttatggaaagaata
agatctggtgcgttgttgtatggagattgtttggtgcactttgtttctccttggctaccc
tttggcggtattggggaaagcggcataggaaaatatcacggcaaatggggctttgaggct
tttaccaatgaaaaggccattgtagataggcccagggttttggatttgcctgtaagatac
ccgccttataataagtggaagatgtcttttataaagcgtcttggtggtttccttactcgt
tttggagttatttag

DBGET integrated database retrieval system