KEGG   Thermosulfidibacter takaii: TST_1636Help
Entry
TST_1636          CDS       T04192                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ttk  Thermosulfidibacter takaii
Pathway
ttk00520  Amino sugar and nucleotide sugar metabolism
ttk01100  Metabolic pathways
ttk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TST_1636 (nagA)
Enzymes [BR:ttk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     TST_1636 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: BAT72420
UniProt: A0A0S3QVS4
Position
complement(1661082..1661990)
Genome map
AA seq 302 aa AA seqDB search
MSEAKKSKPELQLFDQHVHGGGGYSFASDNVETILKAYGAQEEHGTGYLLATYVTLPYER
LRRCLKALREAMKIEKGIIGAYLEGPFINPGKSGGMKTEYITGWNFVDFRRLLEEFADII
KLVVVAPERDADLTILKLVKSYGIKVSIGHTTASYEQTLNYIEQGADMVTHIFNAMAGFH
HRSPGPAVASLLSHVYCEIIPQFDHIHPATLELVFALKKNKLVFISDGTPLAAGGPKRMF
FGGREVFKKDGACYNEEGRLYGSAMTLFEGLRNVSEVLGVKVDDLISMNKNFAESFWGVR
YA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcgaaaaaaagcaagcctgaattgcaattgtttgatcagcacgtccatggg
ggtggtggctatagctttgcctcggataatgtagagaccatcttgaaagcctatggcgct
caggaggaacatggcactggttatctattggcaacttatgtgacattgccctatgaaaga
ttgagaaggtgcttgaaggccttacgagaggctatgaaaatagagaagggaattatagga
gcctatcttgaggggcccttcataaatccaggaaaatcaggaggaatgaaaacagagtac
attacgggctggaattttgtggattttagaaggctgctggaagagtttgcggatattatt
aagcttgtggttgtggcacctgaaagggatgctgatttaactatattgaaattggttaag
tcttatggaataaaggtttccataggacatacaactgcttcatatgagcagactttaaat
tacattgaacaaggtgctgatatggtaacccatatttttaacgccatggcgggttttcat
catagaagtccaggtcctgcagtagcgtcccttttgtctcacgtttactgtgaaatcatt
ccccagtttgatcatatacatccggcaacccttgagttagtttttgctctcaaaaaaaat
aagctggtctttatttccgatggaacaccattggctgctggtggtcctaaaaggatgttc
tttggaggcagagaggtttttaaaaaagatggtgcgtgttacaatgaggagggtagactc
tacgggtctgccatgacgttatttgagggattgagaaatgtttctgaagttctaggtgta
aaggtggatgatttgatttcgatgaataaaaattttgccgaaagcttctggggtgtaaga
tatgcatga

DBGET integrated database retrieval system