KEGG   Thermus thermophilus JL-18: TtJL18_0181Help
Entry
TtJL18_0181       CDS       T02009                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00230  Purine metabolism
ttl00250  Alanine, aspartate and glutamate metabolism
ttl01100  Metabolic pathways
Module
ttl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ttl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TtJL18_0181
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TtJL18_0181
Enzymes [BR:ttl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     TtJL18_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AFH38097
UniProt: H9ZP37
Position
complement(160966..162192)
Genome map
AA seq 408 aa AA seqDB search
MPGIAIIGAQWGDEGKGKVVDVLAREADYVIRYQGGANAGHTVVAEGKVFKLNLLPSGVI
HPHAVNVLGDGMVIDPFRFQEEVEGLRKEGFDPKILVSERAHLVLPHHKHVESRHNFVGT
TGRGIGPAYSDRARRVGIRAGDLLDEATLRERVRRLLAEKPNSTREAGWDTEEKALADLH
RMREILSPYIADTGSLLREAWRKGKRLLFEGAQATLLDLNYGTYPYVTSSHPTVGGILVG
TGLSHKAITKVYGVAKAYATRVGEGPFPTEIHGELAHHLREKGGEYGTTTGRPRRVGWLD
LVALRYACEVNGFDGLVLTKLDVLSGLEKVKVAVEYLDRARPGEASPEAVRYLELPGWGD
LSHVKRREDLPANLLRYLELVEEHTGVPVVLFSTSPRREDTFGAVSWV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcatcgccatcatcggggcgcagtggggcgacgagggcaagggcaaggtggtg
gacgtcctggcccgggaagccgactacgtgatccgctaccagggcggggccaacgccggc
cacaccgtggtggccgagggcaaggtcttcaagctcaacctcctgccctctggggtcatc
cacccccacgcggtgaacgtcctgggggacgggatggtcattgaccccttccgcttccag
gaggaggtggaaggtctgcggaaggaggggtttgaccccaagatcctggtctcggaaagg
gcccacctcgtcctcccccaccacaagcacgtggaaagccgccacaacttcgtgggcacc
acggggcgcggcatcggccccgcctactccgaccgggcgagaagggtggggatccgggcc
ggggaccttttggacgaggccaccctgagggagagggtgcgccgcctcctcgccgagaag
cccaactccacccgggaagcgggctgggacacggaggaaaaggccctcgccgacctccac
cggatgcgggagatcctaagcccctacatcgccgacacggggagcctcctccgggaggcc
tggcgcaaggggaagcgcctcctctttgagggggcccaggccaccctgctggacctgaac
tacggcacctacccctacgtcacgagctcccaccccacggtgggggggatcctggtgggg
acgggcctctcccacaaggccatcaccaaggtctacggcgtggccaaggcctacgccacc
cgggtgggggaaggccccttccccacggagatccacggggaactggcccaccacctgagg
gagaagggcggggagtatggcaccaccacggggaggcccaggagggtgggctggctggac
ctggtggccctccggtacgcctgcgaggtgaacggttttgacggcctcgtcctcacgaag
ttggacgtgctctccgggctggagaaggtgaaggtggccgtggagtacctggacagggcc
cgccccggggaggcgagcccggaggcggtgcgctacctggagcttccgggctggggcgac
ctctcccacgtgaagcgccgggaggacctccccgcaaacctcctccgctacctggagctc
gtggaggagcacaccggggtccccgtggtcctcttctccacgagccccaggcgggaggac
accttcggagcggtgagctgggtctaa

DBGET integrated database retrieval system