KEGG   Thermus thermophilus JL-18: TtJL18_0185Help
Entry
TtJL18_0185       CDS       T02009                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00071  Fatty acid degradation
ttl00280  Valine, leucine and isoleucine degradation
ttl00281  Geraniol degradation
ttl00310  Lysine degradation
ttl00360  Phenylalanine metabolism
ttl00362  Benzoate degradation
ttl00380  Tryptophan metabolism
ttl00410  beta-Alanine metabolism
ttl00627  Aminobenzoate degradation
ttl00640  Propanoate metabolism
ttl00650  Butanoate metabolism
ttl00903  Limonene and pinene degradation
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01212  Fatty acid metabolism
Module
ttl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TtJL18_0185
   00650 Butanoate metabolism
    TtJL18_0185
  Lipid metabolism
   00071 Fatty acid degradation
    TtJL18_0185
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TtJL18_0185
   00310 Lysine degradation
    TtJL18_0185
   00360 Phenylalanine metabolism
    TtJL18_0185
   00380 Tryptophan metabolism
    TtJL18_0185
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TtJL18_0185
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TtJL18_0185
   00281 Geraniol degradation
    TtJL18_0185
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TtJL18_0185
   00627 Aminobenzoate degradation
    TtJL18_0185
   00930 Caprolactam degradation
    TtJL18_0185
Enzymes [BR:ttl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TtJL18_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFH38101
UniProt: H9ZP41
Structure
PDB: 

Position
complement(164200..164994)
Genome map
AA seq 264 aa AA seqDB search
MLASLEARYPGLAFAWPRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLL
RGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGL
ALALAADIAVVGKGARLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEA
ERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEF
LGFSGKELEEGLKALKEKRPPEFP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctctttggaagcccgctacccggggctcgccttcgcctggccgaggcccggc
gtcctggagatcaccttccgcggggagaagctcaacgccatgccccctgccctccaccgg
ggcctggcccgggtgtggcgggacctcgaggcggtggaaggcgtaagggccgtgctcctt
cggggcgagggcggggtcttctccgccgggggctccttcggcctcattgaggagatgcgg
gcctcccacgaggccctcctccgggtcttctgggaggccagggacctcgtgctcgggccc
ctcaacttcccgaggcccgtggtggcggcggtggagaaggtggcggtgggggcggggctt
gccctggccctcgccgccgacatcgccgttgtggggaagggggcgaggcttcttgacggc
cacctccgcctcggggtggcggcgggggaccacgccgtcctcctctggcccctcctcgtg
ggcatggccaaggccaagtaccacctcctcctcaacgagcccctcacgggggaggaggcg
gagcgcctgggcctcgtggctttggcggtggaggacgaaaaggtctacgagaaggccctc
gaggtggcggaaaggctcgcccaaggccccaaggaggccctccaccacaccaagcacgcc
ttaaaccactggtaccgcagcttcctcccccactttgagctctccttggccctggagttt
ttagggttttccgggaaggagctggaggagggcctcaaggccctcaaggagaagcgcccc
cccgagttcccatga

DBGET integrated database retrieval system