KEGG   Thermus thermophilus JL-18: TtJL18_1069Help
Entry
TtJL18_1069       CDS       T02009                                 

Definition
(GenBank) archaeal fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00010  Glycolysis / Gluconeogenesis
ttl00030  Pentose phosphate pathway
ttl00051  Fructose and mannose metabolism
ttl00680  Methane metabolism
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
ttl01230  Biosynthesis of amino acids
Module
ttl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_1069
   00030 Pentose phosphate pathway
    TtJL18_1069
   00051 Fructose and mannose metabolism
    TtJL18_1069
  Energy metabolism
   00680 Methane metabolism
    TtJL18_1069
Enzymes [BR:ttl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TtJL18_1069
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TtJL18_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AFH38964
UniProt: H9ZRK4
Position
981505..982596
Genome map
AA seq 363 aa AA seqDB search
MKVTLSVLKADIGSVGGHTLPSRKVLAKVEEVVREEVGRLLLDAYVFHIGDDIVLLLSHT
RGVRNQEVHALAWKAFREGTEVAKAEGLYGAGQDLLKDAFTGNLHGLGPQVAEMEFTERP
AEPFMVLAADKTEPGAFNLPLYLAFADPMYSSGLLLSPELRPGFRFRIMDLAQTERDSYI
ELDAPERLYDIATLLRDSHRFAIESIWSRKHGEQAAVVSTTRLRNIAGRYVGKDDPVAIV
RTQKIFPATEEFGPVFALAPYVAGDTRGSHHMPLMPVRANTPASTFFCVPMVCGLAFSLR
EGRLSEPVDLFADPVWEAVRAKVVEKAQEMRRQGFYGPAMLPMEELEYTGIAERLKALER
EFS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaccttgagcgtgctcaaggcggacatcggctcggtgggcgggcacaccctg
cccagccgcaaggtcctcgccaaggtggaggaggtggtccgggaggaggtgggccgcctc
cttctggacgcctacgtcttccacatcggcgatgacatcgtcctcctcctatcccacacc
cggggggtgcggaaccaggaggtgcacgccctggcctggaaggccttccgtgagggcacc
gaggtggccaaggccgaaggcctctacggggcgggccaggacctccttaaggacgccttc
acggggaacctccacggcctcgggccccaggtggcggagatggagttcaccgagcgcccc
gcggagcccttcatggtcctcgccgccgacaagaccgagcccggggccttcaacctcccc
ctctacctggccttcgccgaccccatgtactcctcgggcctcctcctttccccggagctt
aggcccggcttccgcttccgcatcatggacctggcccagacggagcgggacagctacatt
gagctggacgcccccgagcgcctctacgacatcgccaccctccttcgcgactcccaccgc
ttcgccatagagtccatctggtcccggaagcacggggagcaggccgccgtggtgagcacc
acgcgcctgaggaacatcgccgggcgctacgtgggcaaggacgatcccgtggccatcgtc
cgcacccagaagatcttccccgccacggaggagttcggccccgtcttcgccctcgccccc
tacgtggcgggggacacccggggaagccaccatatgcccctgatgcccgtgcgggccaac
accccggcctccaccttcttctgcgtgcccatggtgtgcggcctggccttctccttgcgg
gaggggcggctttccgagcccgtggacctcttcgccgaccccgtgtgggaggcggtgcgg
gccaaggtggtggagaaggcccaggagatgcgccgccagggcttctacggccccgccatg
cttcccatggaggagctggagtacacggggatcgccgaacggctgaaggctttggagcgg
gagttcagctaa

DBGET integrated database retrieval system