KEGG   Thermus thermophilus JL-18: TtJL18_1570Help
Entry
TtJL18_1570       CDS       T02009                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00620  Pyruvate metabolism
ttl00630  Glyoxylate and dicarboxylate metabolism
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01200  Carbon metabolism
Module
ttl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TtJL18_1570
   00630 Glyoxylate and dicarboxylate metabolism
    TtJL18_1570
Enzymes [BR:ttl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TtJL18_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI LIX1
Motif
Other DBs
NCBI-ProteinID: AFH39448
UniProt: H9ZSY8
Position
1464653..1466215
Genome map
AA seq 520 aa AA seqDB search
MKGVEIRKDHPLLKEVLTEEALRFVVALHREFNPVRKALLERRQALWERYKAGEKPDFLQ
ETAFVRGGDWKVAEAPPDLLDRRVEITGPVDRKMIINALNSGAKVFMADFEDALSPTWDN
VIRGQKNLYDAVRRQIDFVSPEGKEYKLKEKTATLVVRPRGWHLVEKHVYVDGEPISASL
FDFGLYFFHNAHELLRRGSGPYFYLPKLESHLEARLWNEVFNFAQDYLKIPRGTIRATVL
IETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFATTAPIFPDRAQVTMTVPFMK
AYTELLVKSCHIHEAHAIGGMAAFIPSRKDPTVNERAFQQVRADKEREASQGFDGTWVAH
PDLVPVAQEVFDRYLGDKPHQKHVKREDVQVSAQDLLNFEVPGGKVTEAGLRNNISVALQ
YLNQWLLGNGAAAIFNLMEDAATAEISRAQLWQWVHREAKLEDGRTITPELYQKVKEEEL
AKLGGREVGRYKEAEEILDKLVLSEEFIEFLTLVAYDYID
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtggagatccggaaagaccaccccctcctgaaggaggtcctgacggaggag
gccctgaggttcgtggtggcgctgcaccgggagttcaacccggtgcgcaaggccctcctg
gagcggcgtcaagccctttgggagcggtacaaggccggagagaagccggacttcctccag
gagaccgccttcgtccggggcggggactggaaggtggccgaggcgccgcctgacctcctg
gaccgccgggtggagatcacgggccccgtggaccgcaagatgatcatcaacgccttgaac
tcgggggccaaggtcttcatggcggactttgaagacgccctctcccccacctgggacaac
gtcatccggggccagaagaacctctatgacgccgtgcgccgccaaattgacttcgtctcc
cccgagggcaaggagtacaagctcaaggaaaagacggccaccctggtggtgcgcccaagg
ggctggcaccttgtggaaaagcacgtctacgtggacggggagcccatctcggcgagcctc
tttgactttggcctctacttcttccacaacgcccacgagctcttaaggcgggggagcggg
ccctacttctacctgcccaagctggaaagccacctcgaggcccgcctctggaacgaggtc
ttcaacttcgctcaggactacctgaagatcccccggggcaccatccgggccacggtcctc
attgagaccatcctggcggcctttgagatggaggagatcctctacgagctcaaggagcac
gccgccgggctcaacgccggccgctgggactatatcttcagctgcatcaagaagttcgcc
accaccgcccccatcttccccgaccgggcccaggtgaccatgaccgtgcccttcatgaaa
gcctacaccgagcttttggtgaagtcctgccacatccacgaggcccacgccatcgggggc
atggccgccttcatcccaagccgcaaggaccccacggtgaacgaacgggccttccagcag
gtgcgggccgacaaggaaagggaggcctcccagggctttgacggcacctgggtggcccac
cccgacctggtgcccgtggctcaagaggtctttgaccgctacctgggggacaagccccac
cagaagcacgtgaagcgggaagacgtccaggtgagcgcccaagacctcctgaactttgag
gtccccggcggcaaggtgacggaggcgggcctcaggaacaacatctccgtggccctgcag
tacctgaaccagtggcttttgggtaacggggccgccgccatcttcaacctgatggaggac
gccgccaccgccgagatcagccgggctcagctttggcagtgggtccaccgggaggccaag
ctggaagacggccgcaccatcacccctgagctttaccaaaaggtcaaggaggaagagctc
gccaagcttgggggtagggaggtgggccgctacaaggaggcggaggagatcctggacaag
ctcgtcctctccgaggagttcattgagttcctgaccctggtggcctacgactacattgac
tag

DBGET integrated database retrieval system