KEGG   Thermus thermophilus JL-18: TtJL18_2014Help
Entry
TtJL18_2014       CDS       T02009                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00330  Arginine and proline metabolism
ttl00332  Carbapenem biosynthesis
ttl01100  Metabolic pathways
ttl01130  Biosynthesis of antibiotics
ttl01230  Biosynthesis of amino acids
Module
ttl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TtJL18_2014
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TtJL18_2014
Enzymes [BR:ttl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TtJL18_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFH39866
UniProt: H9ZU56
Position
1862816..1863928
Genome map
AA seq 370 aa AA seqDB search
MRPGLSAKRLVVKVGSAVLTGERGLDLEAMAEIARQVAALREEGREVVLVSSGAVAAGMR
RLGLKERPKDMPKKQALAALGQPLLMAFWQEAFAPFALPVAQVLLTAEDLSSRSRYLNAK
ATLRALLDLGAIPVINENDTVAFEEIRFGDNDQLSARVAALVEAGLLALLSDVDALYEED
PKKNPQARPIAEVESVEAVLAHAGEENPLGSGGMKSKLLAARIAGRVGIPTLLLPGKRPG
VLLQALSGAPLGTYFHARRRYRGEKAWLFGLLRPKGELVLDRGAVRALKERGASLLPAGV
KEVRGRFGRGEAVRLLSEEGEEVGVGLANYASEEIARIKGRRSAEIEAVLGYRYTEEVVH
RDHLALKEEA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccggggctttcggccaagcgcctggtggtcaaggtgggaagcgccgtcctcaca
ggggaaaggggcctggacctcgaggccatggccgagatcgcccgccaggtggccgccctg
agggaggaaggccgggaagtggtcctcgtctcctcgggggcggtggcggcgggaatgcga
cggctcgggctgaaggagcgccccaaggacatgcccaagaagcaggccctcgccgccctc
ggccagcccctcctcatggccttctggcaagaagccttcgcccccttcgccctccccgtg
gcccaggtcctcctcaccgccgaggatctctcctctaggagccgctacctgaacgccaag
gccaccttgcgggcccttctggacctgggggccatacccgtgatcaacgaaaacgacacc
gtggcctttgaggagatccgctttggggacaacgaccagctctccgcccgggtggcggcc
ctggtggaggcgggcctcctcgccctcctctccgatgtggacgccctctacgaggaggac
cccaagaaaaacccccaggcccgccccatcgccgaggtggagtccgtggaggcggttttg
gcccacgccggggaggaaaaccctctaggaagcggggggatgaagagcaagctcctcgcc
gcccgcatcgccggtagggtggggatccccaccctgcttctccccgggaagcggccaggg
gtcctcctccaagccctctccggggcccccctgggcacctacttccacgcgcggcggcgc
taccggggggaaaaggcctggctttttggcctcctccgccccaagggggagctcgtcttg
gaccggggggcggtgcgcgcccttaaggagcggggggcaagcctccttcccgccggggtc
aaggaggtgcggggaaggtttggccggggcgaggcggtccgcctcctctcggaggaaggc
gaggaggtgggggtggggctcgccaactacgcctcggaggagatcgcccgcatcaagggg
cggcggagcgcggagattgaggccgtcctgggctaccgctacaccgaggaggtggtccac
cgggaccacctcgccttgaaggaggaggcatga

DBGET integrated database retrieval system