KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0654Help
Entry
Tthe_0654         CDS       T01299                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tthe_0654
Enzymes [BR:ttm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tthe_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase LBP_M DUF4434 Glyco_hydro_2_C Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADL68213
UniProt: D9TT71
Position
661983..664046
Genome map
AA seq 687 aa AA seqDB search
MTKYKPISEKYPHFLHGGDYNPDQWLNYPRILDEDIRLMKLANWNVVSLGIFAWAAIEPE
EGNYQFEWLDRIMDKLYDNGIYVILATPSAAPPAWLVQKYPEVARVDSNRVRHLFGGRQN
HCFTSPIYREKVRSINRKLAERYKDHPALIAWHVSNEYGNDCHCDLCQEAFRNWLKKKYD
NDIKKLNHEWWSYFWSHTFTDWSQIQTPSPIGETTIHGLNLDYKRFVTDQTVDFFKNEIA
PLKEFTPNIPITTNFMGTFPGLNYWKFAKHLDVISWDSYPTWHGNEEDWVVAYKTAFVHD
INRSLKGGQPFMLMESTPSVTNWQLVSKLKRPGMHALSSIQAVAHGADTVQYFQWRKSRG
GFEKFHGAVVDHCGHENTRVFKDVKEVGEILKRLDPIIGTSVKPEVAIIYDWENSWAIED
AKGPRQEKKDYLLTCQSHYRPFWSKCVPVDVIDMESDFNGYKLLIAPMLYMIKDGVAERI
KQFVKNGGTFVTTYLSGIVNENDLCYLGGFPGPLKEVLGIWSEEIDALHDKDENYVVFNE
TNELGIRGEYKTKELCEIIHLEGARDLAKYKEDFYVGYPAVAVNNYGNGKAYYIAFRNND
DFVDDFYRKIIELLNIKRAIDVDLPVGVTAQLRTDGNREFIFLLNFTDEEKKLDLKDIEY
IDIVDNSMLDGKVMLPPYGFKIIEKGN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtataaaccaataagtgaaaaatatccacactttcttcatggtggagattat
aatccagatcagtggttgaactatccaagaattttggacgaagacataagattgatgaaa
ttggcaaattggaatgtggtaagtttaggtatatttgcttgggcagccatagaaccagaa
gaaggaaattatcaatttgaatggctagatcgtataatggacaagttgtatgataatgga
atatatgtcatacttgcaacgcccagtgctgcacctcctgcatggcttgtgcaaaagtat
ccagaagtagcgagggttgattcaaatagagtaaggcatctctttggaggaaggcagaac
cactgctttacgtctccaatatacagagaaaaagtaagaagtattaatagaaaattagca
gagagatataaagaccatccagcattaattgcttggcatgtatcaaatgaatacggcaat
gattgccattgcgatttatgccaggaagcgtttagaaattggcttaagaaaaaatatgat
aatgatataaaaaaattaaatcatgaatggtggagctacttttggagccatacatttaca
gattggtctcagatacaaacgccatcaccaattggagaaacaacgatacatggattaaac
ttagattacaaaagatttgtaacagatcagacggtagatttttttaaaaatgagattgca
cctttaaaagagtttacaccaaatattcctataacaactaattttatggggacttttccg
ggacttaactattggaaatttgcaaaacatcttgatgtcatatcatgggacagctatcca
acttggcatggaaacgaagaggattgggtagttgcatataaaacagcatttgtccacgac
atcaatcgctcccttaaaggtgggcagccatttatgctaatggaaagcacaccaagtgtt
acaaattggcagctcgtctcaaaattaaaaagaccaggaatgcatgctttatcatcaata
caggcagttgctcatggagcagatactgttcagtattttcaatggagaaaaagcagggga
ggctttgaaaaatttcatggtgcagtagtagatcactgtggacatgaaaacacaagagta
tttaaagatgtaaaagaagtaggagaaatactaaaaaggttagatccgattataggcaca
tccgtaaagccagaggtggctataatttacgattgggagaatagttgggcgatagaagat
gcaaaaggtccgaggcaagaaaaaaaggattaccttttgacatgccaatcgcattatagg
ccattttggagtaaatgtgttccagtagatgtaatcgacatggaaagtgattttaatgga
tacaagttattgatagctccaatgctttacatgataaaagatggtgtagctgaaagaata
aaacaattcgtaaaaaatggtgggacatttgtaacaacatatttaagtggtatagtaaac
gaaaatgatctttgttatctaggtggttttcctggaccgctaaaagaggtgttggggatt
tggagcgaagaaatagatgcattgcacgacaaagatgaaaattatgtagtttttaatgaa
actaacgaattaggcattagaggtgaatataagacaaaggagctttgcgaaattattcat
cttgaaggagcaagagatttagccaaatacaaagaagacttctatgtaggttatcctgca
gtggcagttaataattatggcaatggaaaagcatattatatagcatttaggaataatgat
gattttgtcgatgatttttatcgcaaaataatagaacttttaaatataaaaagagcgata
gatgttgatttgccagttggagttactgctcaattacgaacagatggaaatagagaattt
atattcttgttaaacttcacagatgaagaaaagaaattagatctaaaagacattgaatat
atagatatagtagataatagcatgttagacggaaaagttatgttgccgccttatggattt
aagattatagaaaagggaaactaa

DBGET integrated database retrieval system