KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1656Help
Entry
Tthe_1656         CDS       T01299                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00071  Fatty acid degradation
ttm00280  Valine, leucine and isoleucine degradation
ttm00310  Lysine degradation
ttm00362  Benzoate degradation
ttm00380  Tryptophan metabolism
ttm00620  Pyruvate metabolism
ttm00630  Glyoxylate and dicarboxylate metabolism
ttm00640  Propanoate metabolism
ttm00650  Butanoate metabolism
ttm00900  Terpenoid backbone biosynthesis
ttm01100  Metabolic pathways
ttm01110  Biosynthesis of secondary metabolites
ttm01120  Microbial metabolism in diverse environments
ttm01130  Biosynthesis of antibiotics
ttm01200  Carbon metabolism
ttm01212  Fatty acid metabolism
ttm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ttm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tthe_1656
   00630 Glyoxylate and dicarboxylate metabolism
    Tthe_1656
   00640 Propanoate metabolism
    Tthe_1656
   00650 Butanoate metabolism
    Tthe_1656
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tthe_1656
   00072 Synthesis and degradation of ketone bodies
    Tthe_1656
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tthe_1656
   00310 Lysine degradation
    Tthe_1656
   00380 Tryptophan metabolism
    Tthe_1656
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tthe_1656
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tthe_1656
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tthe_1656
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ttm04147]
    Tthe_1656
Enzymes [BR:ttm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tthe_1656
Exosome [BR:ttm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tthe_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: ADL69165
UniProt: D9TPZ6
Position
complement(1650827..1652005)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIASGVRTAVGKFGGTLLNVPAVDLGAVVIKEALKRANVKPEDVSEVIMGNVLQAG
LGQNPARQAEIKAGIPVEVPAMTVNMVCGSGLRAVTLAAQAVMLGDADIVVAGGMENMSR
APYILNDARFGYRMNNGQLVDEMVYDGLTDVFNQYHMGITAENLAEKYGISREEQDEFAY
RSQKLASEAISSGRFEDEIVPVIVPQKKGEPIEFKVDEHVRPNTTIEALAKLKPAFKKDG
TVTAGNASGINDAAAAVVVMSKEKADELGIKPLATIKSFGYAGVDPSIMGIGPVYATRKA
LEKANLTVDDLDLIEANEAFAAQSLAVAKELKFNMDRVNVNGGAIAIGHPIGASGCRILV
TLLYEMQKRNSHTGLATLCIGGGMGIAMVVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttattgcaagtggtgtaaggactgctgtcgggaaatttggtggaacg
cttctaaatgtacctgcagtagatttaggtgctgtagtaataaaagaagcattaaaaaga
gccaatgtgaaacctgaagatgttagtgaagtgataatgggaaatgtattgcaggcaggt
cttgggcagaaccccgcaagacaagctgaaataaaagcgggcataccagtagaagttccg
gctatgactgtaaacatggtatgtggatcaggtcttagagctgtgacacttgctgctcag
gcagttatgcttggtgatgctgacattgttgtagccggtggaatggaaaatatgtcaaga
gcaccatatatattaaatgatgctcgctttgggtacaggatgaacaatggccagcttgta
gatgaaatggtatatgatggtttaacagatgtttttaaccaatatcacatgggaatcact
gccgaaaatcttgctgaaaaatacggcatatcaagagaagagcaggatgaatttgcatat
agaagccaaaaattagcgtcagaagcgatatcatcaggaagatttgaggatgagatagtt
cctgtgattgtgccgcagaaaaaaggtgaaccgatagaatttaaagttgatgaacatgtg
agacctaatacgacaattgaagcacttgcaaaattaaaaccagcattcaaaaaagatgga
actgtaactgctggaaatgcatcaggaattaacgatgcagctgcagcagtagttgtgatg
tcaaaagaaaaggctgatgaacttggaataaagccattagcaacgattaaatcatttggt
tatgcaggtgttgaccccagcatcatgggaattggtccagtatatgctacgagaaaggca
ttagaaaaagctaatctaactgtagatgatttagatttaattgaagcaaatgaagcattt
gcagcacaatcactggctgttgcaaaagaattaaaatttaatatggacagagtgaatgta
aatggtggcgcaattgcgataggtcatccaatcggcgccagcggatgtagaattctagtg
acgcttttatatgagatgcagaagaggaattcgcatactggacttgcaacattgtgcatc
ggcggaggaatgggaatagcaatggttgtcgaaagatag

DBGET integrated database retrieval system