KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1765Help
Entry
Tthe_1765         CDS       T01299                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00520  Amino sugar and nucleotide sugar metabolism
ttm00550  Peptidoglycan biosynthesis
ttm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tthe_1765
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tthe_1765
Enzymes [BR:ttm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Tthe_1765
Peptidoglycan biosynthesis and degradation proteins [BR:ttm01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Tthe_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADL69262
UniProt: D9TR10
Position
complement(1756819..1758069)
Genome map
AA seq 416 aa AA seqDB search
MKYVIEGGNRLKGEVRINGAKNSVLPILAATLLNKGVSILHSCPKLKDVYSMIEILRHLG
CTVEFNDSDIIVDSSGVIDYHIPDKLMRAMRSSIFLMGALVARNNIAQISFPGGCDIGHR
PIDLHLKSLRKLGISIYESYGYINCKCSSIGGGEIHLDLPSVGATENIMLAASMADGTTV
IGNAAKEPEIEDLQNFLNSMGAKISGAGTNTIVIRGVKELHDTEYTIIPDRIVAGTYLIA
SAITKGEVVLTNVVKRHIDSLLSKLNECGFKIVSGNDFIKLEPCARAKAVDMIITLPFPG
FPTDLQAQMVSLLSTADGTSIITETIFDNRFKYTEELVRMGADIKVDGRIAVVKGVEKLT
GTNVLAKDLRGGAALVLAGLGAVGTTIVEDIEHIDRGYEDFSENLKNLGASIERTM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtaattgaaggaggaaatagattaaaaggtgaagtacggataaacggtgca
aagaattctgtattgccgatacttgctgcaacattattgaacaaaggtgtaagtatttta
cattcatgtccaaaattgaaagatgtgtattctatgatagaaatattgaggcatttgggc
tgtactgtggaatttaatgattcggatattattgttgattccagcggcgttatagattat
cacatccctgataagcttatgagagctatgaggtcatcaatttttttgatgggagctttg
gtagcaagaaataatattgcacagataagttttccaggtggatgcgatatcggacatagg
ccgattgatttgcatttaaaaagcttaagaaagctaggtatatctatatatgaatcatat
ggttatattaactgtaaatgctcttcaataggtggcggtgagatacatttggatttgccc
agcgttggtgctacagaaaacattatgctggcggcgtctatggcagatggaacgactgtg
ataggaaatgcagcaaaagaaccagaaatagaggatcttcaaaactttttgaattctatg
ggtgctaagatttccggtgcaggtaccaatacaattgttatacgtggtgttaaagaatta
catgatacagaatatacgataatacctgataggatagtagctggaacgtatcttattgca
tctgctatcacaaaaggagaagtagttctcacaaatgttgtaaaaagacatatagactct
cttttgtctaagcttaatgagtgtggatttaagatagtatctggtaatgactttataaag
ttagaaccgtgtgcaagagcaaaagccgttgacatgataattactcttccatttccagga
tttccaactgatttacaggcacaaatggtttctcttttgtcgacggcagacggaacatca
ataattacagagacgatatttgacaataggtttaagtatacagaggaactggtaagaatg
ggagcagatataaaagtagatggtcgtattgcagtagtaaaaggtgtcgaaaagttgacg
gggacaaatgttttagcaaaggatttaagaggtggagcagcattagtcttagcaggatta
ggtgcagttggaactacgattgtagaagacatagaacatattgatagaggatatgaggat
tttagtgagaacttaaaaaatcttggtgccagcatagagagaactatgtaa

DBGET integrated database retrieval system