KEGG   Thermoproteus tenax: TTX_0921Help
Entry
TTX_0921          CDS       T01641                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00020  Citrate cycle (TCA cycle)
ttn00640  Propanoate metabolism
ttn00660  C5-Branched dibasic acid metabolism
ttn00720  Carbon fixation pathways in prokaryotes
ttn01100  Metabolic pathways
ttn01110  Biosynthesis of secondary metabolites
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
Module
ttn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttn_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTX_0921 (sucC)
   00640 Propanoate metabolism
    TTX_0921 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TTX_0921 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_0921 (sucC)
Enzymes [BR:ttn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TTX_0921 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp Linocin_M18 RimK Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CCC81572
UniProt: G4RPS7
Position
795838..797001
Genome map
AA seq 387 aa AA seqDB search
MIPKTMKLYEYEAKEIFAKYGVKIPPGKLALSPQEVRKIAEEIGKPVVLKAQVTVAGRGK
AGGIKVAKSPQEAEELAKQMFGMNIKGLTVRKIYVTEYVEVEREMYLSLIIDRASRRYLF
LASPIGGVDIEEIAKREPEKIKRVYVDPFEGLKDFHIRGIVSWLGVKAGTQQWEQAAGIV
KAMYKAMTELEAELVESNPLAVTKSGDVIPLDARIIIDDNALYKHPDLEKAYEEDPRDVT
EFERYAQRIGFNYVELDGDIGIIGNGAGLTMSTMDLVYHYGGRPANFLDIGGGASREVVK
EALKVLLRHPRVKVIFINIFGGITRADEVAAGVEGALNELGNAGKKIIVRMKGTNEELGR
QMLAKIGVPLYESAEEAAQKAVELARI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatcccaaaaactatgaaattgtatgaatacgaagccaaagagatattcgcaaaatac
ggagtcaaaataccgccaggcaaattggctctttcaccgcaggaggttcgcaagatagct
gaggagatcggcaagccggtagtgttaaaggcccaagtcacagtggcgggcagaggaaag
gcgggcggcataaaggtggctaagtcgccgcaagaggcagaggagctggccaagcagatg
ttcggcatgaacatcaagggtcttacagtgaggaagatttacgtgaccgaatatgtggag
gtggagcgcgagatgtacttgagcctcatcatagatagagcctctaggaggtaccttttc
ctcgcctcccctataggcggcgtggacattgaggaaatagccaagagggagccggagaag
ataaagagggtgtacgtagaccccttcgagggactcaaggacttccacatcaggggcata
gtttcatggttgggcgttaaggccggtactcaacagtgggaacaagccgcgggcatagta
aaggcgatgtacaaggccatgacggagctggaggctgagttggtagaaagcaacccgctc
gctgtaacgaaatcgggcgacgttataccgcttgacgcgaggataataatcgacgataat
gcactttacaaacatccagatctagagaaggcctacgaggaggatccgagggatgtgacc
gagttcgagagatatgcccagaggatagggttcaactatgtggaacttgacggagatatc
ggcataataggcaacggcgccggcctcacaatgagcacgatggatttagtatatcactac
gggggcaggcccgcgaacttcttggatataggcggaggagcctcgcgcgaggtggtgaag
gaggcccttaaggtcttgttgaggcatccgagagtcaaggtgatattcattaatatattc
ggaggcataaccagagccgacgaagtggccgcaggcgtcgagggagccttaaacgagttg
ggcaacgctggaaagaagatcatcgtgaggatgaaggggaccaacgaggagttgggcaga
caaatgttggccaaaataggagtccctctatatgaaagtgccgaagaggcggcacaaaaa
gccgtagagttagcgaggatatga

DBGET integrated database retrieval system