KEGG   Thermoproteus tenax: TTX_1277Help
Entry
TTX_1277          CDS       T01641                                 

Gene name
pfp
Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00030  Pentose phosphate pathway
ttn00051  Fructose and mannose metabolism
ttn00052  Galactose metabolism
ttn00680  Methane metabolism
ttn01100  Metabolic pathways
ttn01110  Biosynthesis of secondary metabolites
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_1277 (pfp)
   00030 Pentose phosphate pathway
    TTX_1277 (pfp)
   00051 Fructose and mannose metabolism
    TTX_1277 (pfp)
   00052 Galactose metabolism
    TTX_1277 (pfp)
  Energy metabolism
   00680 Methane metabolism
    TTX_1277 (pfp)
Enzymes [BR:ttn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TTX_1277 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TTX_1277 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Bmp
Motif
Other DBs
NCBI-ProteinID: CCC81911
UniProt: G4RK16
Position
complement(1117238..1118251)
Genome map
AA seq 337 aa AA seqDB search
MKIGVLTGGGDAPGLNIAVYTFVKLAERKHEVYAIYHGWRGLLNKEVKRVSSRDLLDFAF
SGGTYIRTSRTNPFKDEERARLLESNVKELGLDVVVAIGGDDTLGAAGEAQRRGILDAVG
IPKTIDNDVYGTDYTIGFDSAVNAAIEATESFKTTLISHERIGVVEVMGREAGWIALFTG
LSTMADAVLIPERPASWDSVAKRVKEAYNERRWALVVVSEGIKEYGGPKDEYGHSRLGGV
GNELAEYIERSTGIEARAVVLGHTIRGVPPTAFDRILAVRYATAAYEAVENGRYGVMVAY
SNGDIAYVPIVDVVGKNRLVSGYWMRLYETYWPDLAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagataggagttctgacggggggcggcgacgccccgggcctcaacatagcagtctac
acgttcgtgaaactcgccgagaggaagcacgaggtgtacgcgatatatcacgggtggagg
gggctgttgaataaggaggtcaagagggtctcgtcgcgcgacttgttggacttcgccttc
tccggcgggacgtacataaggacgtccaggaccaacccgttcaaagacgaggagagggcg
aggctgcttgagagcaacgtgaaggagcttgggctcgacgtcgtagtggccatagggggc
gacgacacgttgggcgccgccggagaggcccagaggaggggcatactcgacgcagtgggt
ataccgaagacgatagacaacgacgtatacggcaccgactacaccataggcttcgactcg
gcggtgaacgccgcgatagaggcgactgagtccttcaagaccacgttgatttcccacgaa
aggataggcgtcgtcgaagttatgggcagagaggccggctggatagcgctgttcacgggg
ctgtcgacgatggccgacgccgtgttgatacctgagaggccggcgagctgggactcggtg
gccaagagagtcaaggaggcctacaacgagaggcgctgggcccttgtagtggtctccgag
gggatcaaggagtacggagggcccaaggatgaatacggtcactcgaggctggggggcgtc
ggaaacgagctggcggagtatatagagaggagcaccgggatcgaggcgagggccgtggtg
cttgggcacacaatcagaggcgtgccgccgacggcgttcgacagaattttggccgtaagg
tacgccacggcggcctacgaggcggtggagaacggcaggtacggagtgatggtcgcctac
agcaacggggatatagcctatgttcccatagtggacgtggtgggcaagaacaggctggtc
agcgggtattggatgaggctgtacgagacctattggccggacctagcgggctag

DBGET integrated database retrieval system