KEGG   Thermoproteus tenax: TTX_1784Help
Entry
TTX_1784          CDS       T01641                                 

Gene name
oorD
Definition
(GenBank) 2-oxoacid ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00020  Citrate cycle (TCA cycle)
ttn00620  Pyruvate metabolism
ttn00633  Nitrotoluene degradation
ttn00640  Propanoate metabolism
ttn00650  Butanoate metabolism
ttn00680  Methane metabolism
ttn00720  Carbon fixation pathways in prokaryotes
ttn01100  Metabolic pathways
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
Module
ttn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ttn_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_1784 (oorD)
   00020 Citrate cycle (TCA cycle)
    TTX_1784 (oorD)
   00620 Pyruvate metabolism
    TTX_1784 (oorD)
   00640 Propanoate metabolism
    TTX_1784 (oorD)
   00650 Butanoate metabolism
    TTX_1784 (oorD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_1784 (oorD)
   00680 Methane metabolism
    TTX_1784 (oorD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TTX_1784 (oorD)
Enzymes [BR:ttn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TTX_1784 (oorD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_2 Fer4_16 Fer4_10 Fer4_17 Fer4_15 Fer4_8 Fer4_13 Fer4_4 Fer4_22 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CCC82404
UniProt: G4RLF9
Position
1558272..1558535
Genome map
AA seq 87 aa AA seqDB search
MESVLVPVSRPDVGSGGLTGTWRTLRPVVHLDKCIDCGICWLYCPESVIDWERGQKIKID
YNYCKGCGICAHECPVKAIEMAPEGGL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtggagtcggtactagttccggtatcaaggcccgatgtcggctcaggcggtctgacggga
acttggcgcactctgaggcccgtagttcatttagataaatgtatagactgcggcatatgc
tggctctattgccccgagtccgtcatcgattgggagaggggtcagaagataaagatcgac
tacaactactgcaagggatgcgggatatgcgcccacgagtgtcccgttaaagcgatagag
atggcccccgagggcggactatga

DBGET integrated database retrieval system