KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00094Help
Entry
Thethe_00094      CDS       T02407                                 

Definition
(GenBank) protein containing C-terminal region/beta chain of methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00450  Selenocompound metabolism
tto00970  Aminoacyl-tRNA biosynthesis
tto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Thethe_00094
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thethe_00094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tto01007]
    Thethe_00094
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tto03016]
    Thethe_00094
Enzymes [BR:tto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Thethe_00094
Amino acid related enzymes [BR:tto01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Thethe_00094
Transfer RNA biogenesis [BR:tto03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Thethe_00094
 Prokaryotic type
   Other AARSs
    Thethe_00094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Mob1_phocein ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AGB17834
UniProt: L0IGG9
Position
89166..91076
Genome map
AA seq 636 aa AA seqDB search
MAKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRKA
KEKGVTPKQYVDEIVAWIKDLWKTMDISNDKFIRTTDKQHEEIVQKIFTKLYEKGDIYKS
EYEGWYCTPCETFWTEKQLVDGNCPDCGRPVELVKEESYFFKLSNYADKLLKYYEEHPDF
IQPESRLNEMVSFIKSGLEDLCVSRTSFDWGVKVPFDPKHVVYVWIDALSNYITALGYST
DHDEDFKKYWPADVHLVGKEIVRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKMSKS
KGNVVDPKELVSKYGVDAIRYFLLREVPFGADGVFSNEALISRINSDLANDFGNLLSRTV
TMVEKYFDGVVPEVSDKDDVDDELISIANNLPKVVESYMDKLQFSNALAEIWKLVGRANK
YIDETMPWVLAKDESKKGRLKTVLYNLVESLRFVAILITPFMPNTPMKIYEQLGIGDDLR
TWDSLKFGLLKSGTKVKRGENIFPRIDVEKELKEAEKESPKKAEVKEEANYIKIDDFAKI
DLRVAEVLEAEKVEGADKLLKLKLKVGDEVRQVVSGLALHYKSDELVGKKLVLVANLEPK
KLRGIESYGMILAASNEGKLTVVTVDKDIESGAKVK
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgttttacattacaacacctatatattatccaagtgataagctacacata
ggccattcttatacgactgttgctgcagatgcgatggctcggtttaaaaggctgacaggt
tatgacgtgatgtttttgacaggtacagatgagcacggtcagaagatacagagaaaggca
aaagaaaaaggagttacgccgaagcagtatgttgatgaaattgtggcgtggataaaagat
ttgtggaagacaatggacataagcaatgataagttcataaggacaacggacaagcagcat
gaagaaattgtgcaaaagatatttacaaagctttacgaaaagggcgacatatacaaaagc
gaatatgagggatggtattgcacaccttgtgagacgttttggacagagaaacagcttgtg
gatggaaactgccctgactgcggcagacctgtagagcttgttaaagaggaaagctatttc
tttaagctttcaaattacgctgataaacttcttaaatactatgaagagcatccagacttc
atacagccagaatcaaggttgaatgagatggtaagttttataaaatctggtcttgaggat
ttgtgcgtatccagaacgtcctttgactggggcgtaaaggttccatttgatccaaaacac
gttgtatatgtttggattgatgccctttccaactatataactgcattggggtattctaca
gaccacgacgaagatttcaaaaaatactggccggcagatgtgcaccttgttggaaaggaa
atcgtaagattccacaccattatatggcctgcaatgcttatggcgctggatttgcctcta
cctaagaaggtatttggccatggctggcttatattagaaggcggcaagatgtcaaagtca
aagggcaatgtggttgatccgaaagaacttgtttcaaaatacggcgtagatgccataagg
tattttctcttaagagaagttccgtttggggcagatggcgtattttcaaatgaagccttg
atttccaggataaactcagatctcgccaatgactttggaaatcttttaagcaggactgta
acgatggtagaaaaatattttgacggtgtagtacctgaagtttcggataaagatgatgtt
gatgatgagttaatatctatcgcaaataatttgccaaaagttgttgaaagctatatggat
aagctgcagttttcaaatgctcttgcggagatctggaagcttgtaggtcgcgccaataag
tacattgacgagacgatgccatgggtattggcaaaagatgaaagtaaaaaaggaaggctt
aaaactgttctttataaccttgtagaatcactgaggtttgtcgcaattttgataacgcca
tttatgccaaatacgcctatgaagatatatgaacaacttggcatcggcgatgatttaagg
acatgggatagccttaaattcggcttactgaaatcaggcacaaaagtcaaaagaggcgag
aatattttcccgaggatcgatgtagaaaaagagcttaaagaagctgaaaaagaatcgcct
aaaaaagcagaggtaaaagaagaggcaaattacatcaaaatagacgactttgcaaaaatc
gatttgagggttgcagaagtattagaagcggaaaaagtagaaggcgccgacaaattatta
aagcttaagcttaaagtaggcgacgaggtaaggcaagttgtatcaggacttgcactacat
tacaaatcagatgaacttgtaggcaaaaaactcgtcctcgttgctaacttagaacctaaa
aaattaagaggcatagaatcgtacggaatgattttggcagcatcaaacgaaggcaaattg
accgtcgtaactgtcgacaaagatatagaaagcggtgcgaaggtgaaataa

DBGET integrated database retrieval system