KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00968Help
Entry
Thethe_00968      CDS       T02407                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00010  Glycolysis / Gluconeogenesis
tto00030  Pentose phosphate pathway
tto00051  Fructose and mannose metabolism
tto00052  Galactose metabolism
tto00230  Purine metabolism
tto00500  Starch and sucrose metabolism
tto00520  Amino sugar and nucleotide sugar metabolism
tto00521  Streptomycin biosynthesis
tto01100  Metabolic pathways
tto01110  Biosynthesis of secondary metabolites
tto01120  Microbial metabolism in diverse environments
tto01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thethe_00968
   00030 Pentose phosphate pathway
    Thethe_00968
   00051 Fructose and mannose metabolism
    Thethe_00968
   00052 Galactose metabolism
    Thethe_00968
   00500 Starch and sucrose metabolism
    Thethe_00968
   00520 Amino sugar and nucleotide sugar metabolism
    Thethe_00968
  Nucleotide metabolism
   00230 Purine metabolism
    Thethe_00968
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thethe_00968
Enzymes [BR:tto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Thethe_00968
    5.4.2.8  phosphomannomutase
     Thethe_00968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AGB18631
UniProt: L0IK54
Position
973199..974569
Genome map
AA seq 456 aa AA seqDB search
MALNQNMFRMYDIRGVWNDDLTEETAELIGKAFGTYIQNEKGIKDVIVGRDNRISSKPIR
NAVINGLVSTGCNVLDIGVLSTPAFYYSRILFNYDAGLMITASHNPPQFNGFKVAFGPST
IYGDELKKLYHIAEKGDFKTGTGSLKYAYPIQSYIKMIQDKVKLGNRKLKVVVDCGNGTC
SNIYPDIIYGLGCEVYPLYCESDPTFPNHFPDPVNADNLKDLIKEVKRLGADVGIAFDGD
GDRIGVVDEKGNIIWGDMLMVLYWREIMKKHPGADAIVEVKCSKALPEEIKKLGGNPIFY
KTGHSLIKAKMKEINAVFTGEMSGHMFFADEYYGYDDAAYAAARLLRILSNTDKTLSELL
SDVPKYPSTPELRLHCDDEKKFDVVKGVTEYFREKGYDLIDIDGARVMFDGGWGLVRASN
TGPELIVRCEADTEERLKEIKDELAEVLKKYGVELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcactaaatcaaaatatgtttaggatgtatgatataagaggtgtatggaatgatgac
cttaccgaagaaacagcagagcttattggtaaggccttcggtacatatattcaaaatgaa
aaaggtataaaagatgtgattgtaggtagggacaacaggatatcttcaaaacctataaga
aatgcggtaatcaatggacttgtctctactggctgcaatgtgctagatataggtgttcta
tcgacgcctgctttttattattcccgtatactatttaattacgatgcagggcttatgata
acagcaagccacaatccaccgcagtttaacggatttaaagttgcatttggaccatctact
atatatggtgatgagcttaagaagctatatcatattgcagagaaaggcgattttaagaca
gggacaggttctttgaaatacgcatatcccatacaaagctatataaaaatgatacaggat
aaggtaaagcttggcaatagaaagctgaaagttgttgtagactgcggaaacggtacatgc
tcaaatatatatcctgatattatatatgggctggggtgcgaagtatacccgctgtactgc
gaatcagatccgacatttccaaaccattttccggatccagtcaacgcagacaatctgaaa
gacctgataaaagaggtaaaaagacttggtgcagacgttggcatagcttttgacggtgat
ggagataggattggcgtcgttgatgagaagggcaacataatctggggcgatatgctgatg
gtgctttactggagggaaataatgaaaaagcatccaggtgcagatgccatagtcgaagta
aaatgttcaaaggcactgccggaagagataaagaaacttggtggaaatccaatcttttat
aagactggtcacagccttataaaagccaaaatgaaagaaatcaatgctgtctttacaggt
gagatgtctggacacatgttctttgcagacgagtattacggctatgatgatgcggcatat
gctgcagcaaggcttttaagaatactttccaatacggataagacattatcggagcttctt
tctgatgttccaaaatatccgtcaacgccggaattgagattgcactgcgatgatgaaaag
aaatttgatgttgtaaagggcgtgacagagtatttcagagaaaagggatatgatttaata
gatatcgacggtgcaagagttatgtttgacggtggatgggggcttgtcagagcttcaaat
acaggtcctgagttgattgtaaggtgcgaagctgatacagaggaaagattaaaagagatt
aaagatgaacttgcagaagtattaaagaaatacggcgttgagcttaagtaa

DBGET integrated database retrieval system