KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01594Help
Entry
Thethe_01594      CDS       T02407                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00860  Porphyrin and chlorophyll metabolism
tto01100  Metabolic pathways
tto01110  Biosynthesis of secondary metabolites
tto01120  Microbial metabolism in diverse environments
Module
tto_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thethe_01594
Enzymes [BR:tto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Thethe_01594
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Thethe_01594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AGB19231
UniProt: L0ILW0
Position
complement(1551537..1553027)
Genome map
AA seq 496 aa AA seqDB search
MAGFVYLIGAGPGDIGLITLKAIEAIKKADVIVYDRLINDSILAMAKDGTELIDVGKMPD
SHKVPQWRINEIIAEKAMEGKSVVRLKGGDPFVFGRGGEEGEYLYDKGIPFEVIPGITSA
IAVLSYAGIPITHRNLSSSFHVITGHESDGKTENLDWKVIAKLNGTLVFLMGMKNIEFIV
NKLIENGMSKDIPAAVIMNGTTPHQKVVKGTLSDIAEKSRNEGMHNPAIIVIGKVVNMSE
KLDWFEKKRLFGKRVLLTRTYDLAMSTVDDLKDNGADVVICPTIKIIPEVDNVSKLIDNI
EKYDYIIFTSVNGVNVFKKTINLKKFDLRKLNGVKIAAIGSKTCEALNKIYIYPEVVPDE
YTSIALAGKLKSYAKGKSVAILTSDIGGDMLIDNLKDIAFLDKIVAYKNTPNYEIKDKLT
NEIKKGIDIAIFTSTSTFKYMSLILGDDISFLKNVKIAAIGPVTKESIERSGFKVDIMPS
VYTMEELVKDIIKSEE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctttgtttatttaataggtgcggggcctggtgatataggtcttattacatta
aaggcaattgaagcgataaaaaaggcagatgtgattgtatatgacagattgataaatgac
agcatacttgcaatggctaaagatggtactgagcttatagatgttggaaagatgcctgat
tcacataaagtgccacaatggagaataaatgagattattgctgaaaaggctatggagggc
aagtcggtggtgcgattaaaaggcggcgatccgtttgtatttggaagaggcggtgaagaa
ggggagtatctttacgataagggcataccgtttgaagtgattccgggaattacctctgct
atagctgttttgtcttatgcaggtattcctattacacacaggaatttaagttcatcattt
catgttataacaggccatgaatctgacggtaaaactgaaaatctcgattggaaagtgatt
gctaaactcaatggtactcttgtatttttgatgggtatgaagaacatcgaatttatagta
aataaactgattgaaaatggtatgtctaaagatattcctgctgctgtaataatgaatggg
actacgccgcatcaaaaggtggtaaagggcactttatcagatattgcagaaaagtcccgc
aatgaaggtatgcacaatccagcaataattgtcattggaaaagttgtaaacatgagtgaa
aagcttgactggttcgaaaagaaacgactttttggaaagagagtccttttaacaaggaca
tacgacttagctatgagtactgtggatgatttaaaagataatggggcagatgtcgtcata
tgcccaactataaagataattccggaagtagataatgtatcaaagcttattgataatatt
gaaaaatacgattatattattttcacaagtgtaaatggcgtcaacgtctttaaaaaaact
atcaatttaaagaaatttgatttaagaaaattgaatggagtaaagattgcagcgataggc
agtaagacatgtgaggctctaaataaaatatatatatatccagaggttgtgcctgatgaa
tatacttctatagctttagctggtaagcttaagagttatgcaaaagggaaaagtgtggcg
attttgacttctgacataggtggcgatatgcttatagacaatctcaaagatatcgccttt
ttagataagattgtggcgtataaaaataccccaaattatgaaataaaagataaattaacg
aatgagattaaaaagggtattgatatagcaatatttacaagcacatcaacatttaaatac
atgtctttaatattaggagatgatatatctttcttaaaaaatgtaaaaatagctgcaata
ggacctgtgacgaaagaatcaatagaaagaagtggttttaaagttgatataatgccaagc
gtatatacgatggaagaattagtcaaagatataataaaaagtgaggaataa

DBGET integrated database retrieval system