KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01663Help
Entry
Thethe_01663      CDS       T02407                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00071  Fatty acid degradation
tto00280  Valine, leucine and isoleucine degradation
tto00310  Lysine degradation
tto00362  Benzoate degradation
tto00380  Tryptophan metabolism
tto00620  Pyruvate metabolism
tto00630  Glyoxylate and dicarboxylate metabolism
tto00640  Propanoate metabolism
tto00650  Butanoate metabolism
tto00900  Terpenoid backbone biosynthesis
tto01100  Metabolic pathways
tto01110  Biosynthesis of secondary metabolites
tto01120  Microbial metabolism in diverse environments
tto01130  Biosynthesis of antibiotics
tto01200  Carbon metabolism
tto01212  Fatty acid metabolism
tto02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thethe_01663
   00630 Glyoxylate and dicarboxylate metabolism
    Thethe_01663
   00640 Propanoate metabolism
    Thethe_01663
   00650 Butanoate metabolism
    Thethe_01663
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Thethe_01663
   00072 Synthesis and degradation of ketone bodies
    Thethe_01663
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Thethe_01663
   00310 Lysine degradation
    Thethe_01663
   00380 Tryptophan metabolism
    Thethe_01663
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thethe_01663
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Thethe_01663
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thethe_01663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tto04147]
    Thethe_01663
Enzymes [BR:tto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Thethe_01663
Exosome [BR:tto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thethe_01663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: AGB19299
UniProt: L0IKN3
Position
complement(1621416..1622594)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIASGVRTAVGKFGGTLLNVPAVDLGAVVIKEALKRANVKPEDVSEVIMGNVLQAG
LGQNPARQAEIKAGIPVEVPAMTVNMVCGSGLRAVTLAAQAVMLGDADIVVAGGMENMSR
APYILNDARFGYRMNNGQLVDEMVYDGLTDVFNQYHMGITAENLAEKYGISREEQDEFAY
RSQKLASEAISSGRFEDEIVPVIVPQKKGEPIEFKVDEHVRPNTTIEALAKLKPAFKKDG
TVTAGNASGINDAAAAVVVMSKEKADELGIKPLATIKSFGYAGVDPSIMGIGPVYATRKA
LEKANLTVDDLDLIEANEAFAAQSLAVAKELKFNMDRVNVNGGAIAIGHPIGASGCRILV
TLLYEMQKRNSHTGLATLCIGGGMGIAMVVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttattgcaagtggtgtaaggactgctgtcgggaaatttggtggaacg
cttctaaatgtacctgcagtagatttaggtgctgtagtaataaaagaagcattaaaaaga
gccaatgtgaaacctgaagatgtcagtgaagtgataatggggaatgtattgcaggcaggt
cttgggcagaaccccgcaagacaagctgaaataaaagcgggcataccagtagaagttccg
gctatgactgtaaacatggtatgtggatcaggtcttagagctgtgacacttgctgctcag
gcagttatgcttggtgatgctgacattgttgtagccggtggaatggaaaatatgtcaaga
gcaccatatatattaaatgatgctcgctttgggtacaggatgaacaatggccagcttgta
gatgaaatggtatatgatggtttaacagatgtttttaaccaatatcacatgggaatcact
gccgaaaatcttgctgaaaaatacggcatatcaagagaagagcaggatgaatttgcatat
agaagccaaaaattagcgtcagaagcgatatcatcaggaagatttgaggatgagatagtt
cctgtgattgtgccgcagaaaaaaggtgaaccgatagaatttaaagttgatgaacatgtg
agacctaatacgacaattgaagcacttgcaaaattaaaaccagcattcaaaaaagatgga
actgtaactgctggaaatgcatcaggaattaacgatgcagctgcagcagtagttgtgatg
tcaaaagaaaaggctgatgaacttggaataaagccattagcaacgattaaatcatttggt
tatgcaggtgttgaccccagcatcatgggaattggtccagtatatgctacgagaaaggca
ttagaaaaagctaatctaactgtagatgatttagatttaattgaagcaaatgaagcattt
gcagcacaatcactggctgttgcaaaagaattaaaatttaatatggacagagtgaatgta
aatggtggcgcaattgcgataggtcatccaatcggcgccagcggatgtagaattctagtg
acgcttttatatgagatgcagaagaggaattcgcatactggacttgcaacattgtgcatc
ggcggaggaatgggaatagcaatggttgtcgaaagatag

DBGET integrated database retrieval system