KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01906Help
Entry
Thethe_01906      CDS       T02407                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00010  Glycolysis / Gluconeogenesis
tto00052  Galactose metabolism
tto00500  Starch and sucrose metabolism
tto00520  Amino sugar and nucleotide sugar metabolism
tto00521  Streptomycin biosynthesis
tto01100  Metabolic pathways
tto01110  Biosynthesis of secondary metabolites
tto01120  Microbial metabolism in diverse environments
tto01130  Biosynthesis of antibiotics
tto01200  Carbon metabolism
Module
tto_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thethe_01906
   00052 Galactose metabolism
    Thethe_01906
   00500 Starch and sucrose metabolism
    Thethe_01906
   00520 Amino sugar and nucleotide sugar metabolism
    Thethe_01906
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thethe_01906
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thethe_01906
Enzymes [BR:tto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thethe_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pico_P2B
Motif
Other DBs
NCBI-ProteinID: AGB19517
UniProt: L0INF6
Position
complement(1877600..1878487)
Genome map
AA seq 295 aa AA seqDB search
MKKVIGIDIGGTKILGGVIGSNGDLIKFKETSTDANLGRDHILKKLFGVLDDLFDADIEG
IGIGSAGRIDFNTGEVIYATDNLPGWTGINLKEIISQKYKTKTIVENDVNAAIIGENWVG
SAKNYRDILMITLGTGVGGAIILDGKLIRGSHFSAAEIGHTILYPDGKKCNCGQNGCVEQ
YISGTAIYKRYNELAGSNMVNSAKDVFDLFIKNDEISKLVLDEFVKSLSLLIFNIRNFID
PEIIILGGGVTNSKDLWWEYLKSQIKCDLNISIAGLNNFSTAYGAAKLILNEGVV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttattggtatagatattggtggtacaaaaattttaggtggtgttattggt
tctaatggagatttaattaaatttaaagagacttcaacagatgctaatttaggcagagat
cacatattgaaaaaattattcggtgtattagatgatttatttgatgctgatatagaaggg
attggcattggttcggccggtagaattgattttaatacaggcgaagttatttatgctacg
gataatttaccaggttggactggcataaatttaaaagaaattatttctcaaaaatataag
acaaaaacaatagttgaaaatgatgttaatgcggcaattattggtgaaaattgggtaggt
tctgctaaaaattatagagatattttaatgataactttagggacaggtgttgggggtgca
ataatactagatggtaaattgataagaggaagtcatttcagcgcagcggaaatcggccat
actatcctatatcctgatggcaagaagtgcaactgcgggcaaaatggttgcgttgaacaa
tatatatcgggtactgcaatatataaaagatacaatgaattagcgggttctaatatggtg
aatagtgcaaaagatgtttttgatctgtttataaagaacgatgaaatatcaaagttagtt
ttagatgaatttgtaaaatcgctctcattattaatttttaacataagaaattttattgat
cctgaaataatcatcctcggaggtggtgtaacaaattcaaaagatctgtggtgggaatat
ttaaaatcacaaataaaatgtgatttaaatatttctattgcaggacttaataacttttcg
acagcatatggcgctgcaaaattaattttaaatgagggggttgtctaa

DBGET integrated database retrieval system