KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_02415Help
Entry
Thethe_02415      CDS       T02407                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Brite
KEGG Orthology (KO) [BR:tto00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Thethe_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGB19983
UniProt: L0IM93
Position
complement(2375699..2376697)
Genome map
AA seq 332 aa AA seqDB search
MNLYLILIAFIFIYIFITGFHDEGNLIATIISSRSMSIRSAFITASLAQFIGTATLSTTV
ASTISKDVVRLNYLNINRDNLYIMIFTGLLGAVIWNLITWYFGMPSSSSHALVGGMIGPF
IAQYGLKSVNIFGILLKVIIPLFLSPILGFLIGYLVMNTTSHLLIAAGPRVNTVLKRLQY
ITLFILNAGQGANDAQKGMGLISIVLMKSGISQSFMLPHWVKILSAIMISFGLLFGGLRM
IKSVGTRIYRVKPFHSFNAQISSLFIVITAAVFGLPTSGTQIINSSVLGVGAKERPTAVR
WQFAKGMFTAWIITIPASFALSSLIFVIVKSI
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatacttgattcttattgcatttatatttatatatatctttattacaggattt
catgatgaaggaaatctcatagctaccatcatatcttctagatctatgagcataagaagt
gcatttataacggcgtctttagctcaatttatcggcacagctactttaagtacaactgtc
gcttctacaattagcaaagacgtggtgcgtctaaattatctgaatataaatagagataat
ttatatataatgatatttacaggcttacttggtgcagtaatttggaatctgataacgtgg
tattttggcatgccgtccagttcatcccatgcattagtgggtggaatgataggaccattt
atagcccaatatgggcttaaatcggttaatatttttggaatactgcttaaggtaataata
cctctttttttatcaccaattttaggatttttgataggatatttagtgatgaatactaca
agtcatttattaatagcagcgggacctagagttaatactgttttaaaaagacttcaatat
ataacgttgtttattttaaatgcaggtcaaggtgctaatgatgcgcaaaagggaatgggc
cttatatcaattgttttaatgaaaagcggaatttcacaaagctttatgctgcctcactgg
gtcaaaattttatcagcaattatgatatcttttggactactttttggcgggcttagaatg
attaaaagcgttggtactagaatatacagggttaagccatttcattcatttaatgcgcag
atatcgtcgctatttatagttataactgctgcagtttttggcttgccaaccagcggaacg
cagataataaactcatctgtactaggggttggagctaaagagaggccaactgcagtgaga
tggcagtttgcaaagggaatgtttactgcttggattattactattccagcgtcttttgcc
ttatcttcattaatatttgtgattgtaaaatccatctaa

DBGET integrated database retrieval system