KEGG   Thermobaculum terrenum: Tter_0018Help
Entry
Tter_0018         CDS       T01134                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00010  Glycolysis / Gluconeogenesis
ttr00052  Galactose metabolism
ttr00500  Starch and sucrose metabolism
ttr00520  Amino sugar and nucleotide sugar metabolism
ttr00521  Streptomycin biosynthesis
ttr01100  Metabolic pathways
ttr01110  Biosynthesis of secondary metabolites
ttr01120  Microbial metabolism in diverse environments
ttr01130  Biosynthesis of antibiotics
ttr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tter_0018
   00052 Galactose metabolism
    Tter_0018
   00500 Starch and sucrose metabolism
    Tter_0018
   00520 Amino sugar and nucleotide sugar metabolism
    Tter_0018
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tter_0018
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tter_0018
Enzymes [BR:ttr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tter_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACZ40941
UniProt: D1CDD5
Position
1:18876..19841
Genome map
AA seq 321 aa AA seqDB search
MSNRYVIGVDLGGSRVRAVLANEKGEFLDRCEFPTLADKGLYFVLERILECVRSVSSNAP
RIDAIGVGAPGPINSKEGVVSNPPNLPGWVNVPLAKLIEEKTGIPTFLGNDANLAALGEF
TYGSGKYVQHLIYITVSTGVGGGIIIDGQLLEGHNGAAGEVGHMVVQPGGPKCSCGGYGH
LEALSSGTAIAKRAREAASLNKDTIMIELAGSVDKINAKIVDEAAKKGDPLALKLLEQAG
QWLGYALINLIHIFNPQMISIGGGVSEAGELLLGPARKVVFEGLMPVFKQDLQIVKASLG
GDVGLAGAVALALQESAKSKV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatagatacgttataggtgtagacctcggaggtagccgagtaagagcagtattg
gccaacgagaagggagagtttctggatcgttgtgagttccctacgctagcagacaagggg
ctctactttgtgctagagaggatcttggagtgcgtccgatctgtatcctccaatgcccct
agaatagatgctatcggcgttggagcacctggacccatcaactccaaggaaggtgtggtg
agtaatcctccaaacctgcctgggtgggtcaatgtaccgcttgcaaaactcatagaagag
aagacaggcatccccactttcttgggtaatgatgctaaccttgcagcacttggagagttc
acttatggctctggtaagtatgtacagcacctgatttacatcaccgtcagcacaggtgta
ggtggcggcatcattatagacgggcagctactggagggacacaacggtgctgctggggag
gtaggccacatggtcgtccagcccggaggacctaagtgctcctgcggaggatacggtcat
ctcgaggcgctctcttcgggtacagccatagccaaacgggccagggaggccgcgtccctt
aacaaagacacgatcatgatcgagcttgcaggctccgtagacaagatcaatgccaagatc
gtggatgaggctgccaagaaaggcgacccacttgccctcaagcttctggagcaagcagga
caatggctaggatatgcactcatcaacctgatacacatcttcaaccctcaaatgatctcc
atagggggaggtgtatccgaagctggcgagctgctgctagggcccgccagaaaggtcgta
ttcgaaggactaatgccggtcttcaagcaggacctacagatagttaaagctagtctggga
ggtgatgtaggtttggcgggggcagtagccctggctcttcaggaatctgccaaatctaag
gtctaa

DBGET integrated database retrieval system