KEGG   Thermobaculum terrenum: Tter_0786Help
Entry
Tter_0786         CDS       T01134                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00020  Citrate cycle (TCA cycle)
ttr00190  Oxidative phosphorylation
ttr00650  Butanoate metabolism
ttr01100  Metabolic pathways
ttr01110  Biosynthesis of secondary metabolites
ttr01120  Microbial metabolism in diverse environments
ttr01130  Biosynthesis of antibiotics
ttr01200  Carbon metabolism
Module
ttr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tter_0786
   00650 Butanoate metabolism
    Tter_0786
  Energy metabolism
   00190 Oxidative phosphorylation
    Tter_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACZ41703
UniProt: D1CFJ7
Position
1:complement(840609..840989)
Genome map
AA seq 126 aa AA seqDB search
MYDRRRAERPTGTFELWSWYYFRISGVLLLFLALGHVYIMHIATPVEQINYAFVAARYAT
PFWRTYDLVLLLLAMSHGVNGIRVIIHDYIRSRSWRLFALSALYSISLIFTVLGALVILT
FQPQTS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatagacgaagggcagagaggccgacaggcaccttcgagctttggtcttggtat
tacttcaggatttcaggcgtgcttcttctgtttctggcactagggcatgtgtacatcatg
catatagccactcctgttgagcagataaactatgctttcgtggcagctagatatgcaact
ccattctggaggacttacgatctagtattgttgctattggctatgagtcatggagtcaac
ggtataagagtaataatccacgactacatcagatcccgcagctggcggttgtttgcgcta
tcagccctttactccatatctctcatattcacggttctcggagcgttggtaatactaacc
ttccaacctcagactagctaa

DBGET integrated database retrieval system