KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0537Help
Entry
Ththe16_0537      CDS       T01867                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00020  Citrate cycle (TCA cycle)
tts00640  Propanoate metabolism
tts00660  C5-Branched dibasic acid metabolism
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01130  Biosynthesis of antibiotics
tts01200  Carbon metabolism
Module
tts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ththe16_0537
   00640 Propanoate metabolism
    Ththe16_0537
   00660 C5-Branched dibasic acid metabolism
    Ththe16_0537
Enzymes [BR:tts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ththe16_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AEG32963
UniProt: F6DEK8
Position
complement(503876..505051)
Genome map
AA seq 391 aa AA seqDB search
MPLTGVARQGRWVLNLHEYQAKEILARYGVPVPPGKVAYTPEEAKRIAEEFGKRVVIKAQ
VHVGGRGKAGGVKLADTPQEAYEKAQAILGMNIKGLTVKKVLVAEAVDIAKEYYAGLILD
RAKKRVVLMLSKEGGVDIEEVAAERPEAIHKFWIDPHKGFRPFEAREMVKRAGLEGNLNK
LAQVLVALYRAYEGVDASIAEINPLVVTTDGGIVAADAKIVLDDNALFRHPDLAELREVE
AEHPLEVEASNYGFAYVKLDGNIGIIGNGAGLVMYTLDLVNRVGGKPANFLDIGGGAKAD
VVYNALKVVLKDPDVKGVFINIFGGITRADEVAKGVIRALEEGLLTKPVVMRVAGTAEEE
AKKLLEGKPVYMYPTSIEAAKAIVAMVGGAA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgaccggggtcgcccggcaagggaggtgggtcttgaacctgcacgagtatcaa
gcgaaggagatcctggcccgctatggggtgcccgtgccgccgggaaaggtggcctacacc
cccgaggaggccaaacggatcgccgaagagttcggcaagcgggtggtcatcaaggcccag
gtgcacgtgggagggagaggaaaggcggggggcgtcaagctcgccgacaccccccaggag
gcctacgagaaggcccaggccatcctgggcatgaacatcaagggcctcaccgtgaagaag
gtcctggtggccgaggcggtggacatcgccaaggagtactacgcgggcctcatcctggac
cgggccaagaagcgggtggtcctcatgctctccaaggaggggggcgtggacattgaggag
gtggccgcggagcgccccgaggccatccacaagttctggatagacccccacaaggggttc
cgcccctttgaggcccgggagatggtgaagcgggcggggctggagggcaacctcaacaag
ctcgcccaggtcctggtggccctctaccgggcctacgagggcgtggacgcctccatcgcc
gagatcaaccccctggtggtgaccacggacggcgggatcgtcgccgccgacgccaagatc
gtcctggacgacaacgccctcttccgccaccccgacctggccgagctcagggaggtggag
gccgaacaccccttggaggtggaggccagcaactacggcttcgcctacgtgaagcttgat
ggcaacatcggcatcatcggcaacggggcgggcctcgtgatgtacaccctggatctggtg
aaccgggtagggggcaagcccgccaacttcctggacatcggcggcggggccaaggcggac
gtggtctacaacgccctcaaggtggtcctcaaggaccccgacgtcaagggggtcttcatc
aacatcttcggcggcatcacccgggcggacgaggtggccaagggggtgatccgcgccctg
gaggagggcctcctcaccaagcccgtggtgatgcgggtggcgggcaccgccgaggaggag
gccaagaagcttttggaggggaagcccgtctacatgtaccccacgtccattgaggcggcc
aaggccatcgtggccatggtgggaggtgcggcgtga

DBGET integrated database retrieval system