KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1910Help
Entry
Ththe16_1910      CDS       T01867                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00300  Lysine biosynthesis
tts00680  Methane metabolism
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01210  2-Oxocarboxylic acid metabolism
tts01230  Biosynthesis of amino acids
Module
tts_M00433  Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:tts00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Ththe16_1910
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Ththe16_1910
Enzymes [BR:tts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Ththe16_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: AEG34302
UniProt: F6DFW5
Position
complement(1810652..1811143)
Genome map
AA seq 163 aa AA seqDB search
MPRVWKFGDQINTDDILPGKYAPFMVGEDRFHLYAFAHLRPEFAKEVRPGDILVFGRNAG
LGSSREYAPEALKRLGVRAIIAKSYARIFFRNLVNLGIVPFESEEVVDALKDGDEVELDL
ESGVLTRGEERFLLRPPPPFLLEALKEGSLLDYYKRHGRFPGE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcctagggtctggaagttcggcgaccagatcaacaccgacgacatccttcccggaaag
tacgcccccttcatggtgggggaggaccggtttcacctctacgccttcgcccacttgagg
cccgagttcgccaaggaggtgcgccccggggacatcctcgtcttcgggcggaacgcgggg
ctcggctctagccgcgagtacgcccccgaggccctgaagcgcctcggcgtccgggccatc
atcgccaaaagctacgcccgcatcttcttccgcaacctggtgaacctggggatcgtcccc
tttgagtcggaggaggtggtggatgcgctaaaagacggcgacgaggtggagttggacctg
gaaagcggggtgctcacccggggggaggagcgcttcctcctccgtcccccgccccccttc
ctcctggaggcgctcaaggagggctccctcctggactactacaagaggcacgggcgcttc
ccgggggagtag

DBGET integrated database retrieval system