KEGG   Thermothielavioides terrestris: THITE_155704
Entry
THITE_155704      CDS       T02228                                 

Definition
(RefSeq) delta(14)-sterol reductase like protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ttt  Thermothielavioides terrestris
Pathway
ttt00100  Steroid biosynthesis
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
Module
ttt_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    THITE_155704
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     THITE_155704
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 11524539
NCBI-ProteinID: XP_003655385
JGI: Thite2_155704
UniProt: G2RB78
Position
4:join(1842113..1842174,1842232..1842536,1842593..1843683)
AA seq 485 aa
MAPKTKQRAVSKTHGYEFFGPPGAAAISFGLPVLIYAFAFACNDISGCPAPSLLHPKSLD
LDVLKREVGWPHDGLRGLVSWRATGWTLAYYLFSAVLYRVLPGTETEGTKLANGGRLKYK
FNAFSSTMFTLAICAAGTFAQGAEFPLWTFITDNYLQILTANIIIAYSLATFVYIRSFSV
KPGNPQFRELAAGGVTGNMLYDWFIGRELNPRVTLPLIGEIDIKEFMEIRPGLTGWILLN
CAFVAKQYRTFGFVTDSIIFIAVVQALYVLDGQFMEPAILTTIDIISDGFGLMLSFGDLV
WVPFLYTQQTRYLSVHPQSLGPLGLAGVGALLAAGFAIFRLSNSQKNAFRTDPNDPAVAH
LKYIETKAGTRLLVSGWWGIARHINYFGDWLQAWPYCLPTGLAGYTILTAGTSAEGAIRM
LDGREVVPGEARGWGTIFTYFYIVYFAVLLIHRDRRDDEKCSRKYGEDWEKYKRIVRWRI
VPYVY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcgccgaaaacgaagcagcgcgctgtgtccaagacgcatggttatgagttttttgga
ccgcccggtgccgccgccatcagcttcggcctgccagtgctcatctacgccttcgctttt
gcctgcaacgacatttcaggatgccccgcaccttctctcctccacccaaagtcgctcgat
ctcgatgtcttgaaaagagaggttggatggccccatgacggacttaggggcctcgtgagt
tggcgggcgaccggctggacgctggcatactatctcttcagtgccgtcctgtacagggtg
ctgccggggaccgagaccgagggaacgaagctcgccaatggcggccggttaaagtataag
ttcaatgccttttcgtcgaccatgttcacgctggctatctgcgccgccggcaccttcgcc
cagggcgccgagttccccctgtggacgttcatcaccgacaactacctccagatcctgacc
gccaacatcattattgcctacagcctcgcaaccttcgtctacatccgcagcttcagtgtc
aaaccgggcaacccgcagttccgcgaattggccgccggtggcgtcacgggcaacatgctc
tacgactggtttatcgggcgcgagctcaacccgcgcgtcacgctgcccctcatcggcgag
atcgacatcaaggagtttatggagatccgccctgggcttacgggctggatcctgctcaac
tgcgccttcgtggctaagcagtaccgcaccttcggcttcgtgaccgatagcatcatcttc
atagcggtggtccaggcgctctacgtccttgacggccagttcatggagcccgccatcctc
accaccatcgatatcattagcgacggcttcggcctgatgctctcctttggcgacctcgtc
tgggtgcccttcctgtacacccagcagacgcgctacctttcggtgcacccgcagtcgctc
ggcccgcttggcctcgccggcgtcggcgcgctgctggccgcgggcttcgcgatcttccgc
ctgtccaacagccagaagaacgcgttccgcaccgaccccaacgacccggccgtcgcccac
ctcaagtacatcgagaccaaggccggcacgcggctgctcgtctcgggctggtggggcatc
gcgcgccacatcaactactttggcgactggctgcaggcctggccgtactgcctgccgacg
ggtttggctgggtacacgatcctgactgcgggcacgtcggccgagggcgcgatccgcatg
ctggacggcagggaggtggtgcccggcgaggcgcgcggctggggcaccatcttcacgtac
ttttacattgtctactttgccgtgctgctcatccaccgcgatcggagggacgacgagaag
tgctcgcgcaagtacggcgaggattgggagaagtataagaggattgtgaggtggcgcatc
gtgccctatgtgtactag

DBGET integrated database retrieval system